KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_02418Help
Entry
SAT0131_02418     CDS       T01888                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
Pathway
sut03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sut00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SAT0131_02418
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sut03011]
    SAT0131_02418
Ribosome [BR:sut03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SAT0131_02418
  Bacteria
    SAT0131_02418
  Archaea
    SAT0131_02418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Peptidase_C92
Motif
Other DBs
NCBI-ProteinID: AEB89341
Structure
PDB: 

Position
complement(2366098..2366451)
Genome map
AA seq 117 aa AA seqDB search
MEAKAVARTIRIAPRKVRLVLDLIRGKNAAEAIAILKLTNKASSPVIEKVLMSALANAEH
NYDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGKEEAKEA
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaagcggttgctagaacaataagaatcgcacctcgtaaagtaagactagtt
cttgacttaatcagaggtaaaaatgctgctgaagctattgcaattttaaaattaacaaac
aaagcttcatcaccagtaattgaaaaagtattaatgtccgctttagctaatgctgaacat
aactatgacatgaacacagatgaattagtagttaaagaagcatatgctaacgaaggacca
acattaaaacgtttccgtccacgtgcgcaaggtcgtgcaagtgcgattaacaaacgtaca
agccacattacaatcgtcgtaagtgacggtaaagaagaagctaaagaagcttaa

DBGET integrated database retrieval system