KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_02754Help
Entry
SAT0131_02754     CDS       T01888                                 

Definition
(GenBank) Hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
Pathway
sut00900  Terpenoid backbone biosynthesis
sut01110  Biosynthesis of secondary metabolites
sut01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sut00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAT0131_02754
Enzymes [BR:sut01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     SAT0131_02754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red YAcAr UPF0180
Motif
Other DBs
NCBI-ProteinID: AEB89637
Position
complement(2676398..2677675)
Genome map
AA seq 425 aa AA seqDB search
MQNLDKNFRHLSRKEKLQQLVDKQWLSEEQFDILLNHPLIDEEVANSLIENVIAQGALPV
GLLPNIIVDDKAYVVPMMVEEPSVVAAASYGAKLVNQTGGFKTVSSERIMIGQIVFDGVD
DTEKLSADIKALEKQIHKIADEAYPSIKARGGGYQRIAIDTFPEQQLLSLKVFVDTKDAM
GANMLNTILEAITAFLKNEFPQSDILMSILSNHATASVVKVQGEIDVKDLARGERTGEEV
AKRMERASVLAQVDIHRAATHNKGVMNGIHAVVLATGNDTRGAEASAHAYASRDGQYRGI
ATWRYDQDRQRLIGTIEVPMTLAIVGGGTKVLPIAKASLELLNVESAQELGHVVAAVGLA
QNFAACRALVSEGIQQGHMSLQYKSLAIVVGAKGDEIAKVAEALKKEPRANTQAAEHILQ
EIRQQ
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatttagataagaattttcgacatttatctcgtaaagaaaagttacaacaattg
gttgataagcaatggttatcagaagaacaattcgacattttactgaatcatccattaatc
gatgaagaagtagccaatagtttaattgaaaatgtcatcgcgcaaggtgcattacccgtt
ggattattaccgaatatcattgtggacgataaggcatatgttgtacctatgatggtggaa
gagccttcagttgtcgctgcagctagttatggtgcaaagctagtgaatcagactggcgga
tttaaaacggtatcttctgaacgtattatgataggtcaaatcgtctttgatggcgttgac
gatactgaaaaattatcagcagacattaaagctttagaaaagcaaattcataaaattgcg
gatgaggcatatccttctattaaagcgcgtggtggtggttaccaacgtatagcgattgat
acatttcctgagcaacagttactatctttaaaagtatttgttgatacgaaagatgctatg
ggcgctaatatgcttaatacgattttagaggccataactgcatttttaaaaaatgaattt
ccgcaaagcgacattttaatgagtattttatccaatcatgcaacagcgtccgttgttaaa
gttcaaggcgaaattgatgttaaagatttagcaaggggcgagagaactggagaagaggtt
gccaaacgaatggaacgtgcttctgtattggcccaagtagatattcatcgtgcagcaaca
cataataaaggtgttatgaatggcatacatgctgttgttttagcaacaggaaatgatacg
cgtggtgcagaagcaagtgcgcatgcatacgcgagtcgtgacggacagtatcgtggtatt
gctacatggcgttacgatcaagatcgtcaacgattgattggtacaattgaagtgcctatg
acattggcaatcgttggcggtggtacaaaagtattaccaattgctaaagcttcattagag
ctactaaatgtagagtcagcacaagaattaggtcatgtagttgctgccgttggtttagcg
caaaactttgcagcatgtcgcgcgcttgtgtcagaaggtattcaacaaggtcatatgagt
ttacaatataaatcattagctatcgttgtaggggcaaaaggtgatgaaattgctaaagta
gctgaagctttgaaaaaagaaccccgtgcaaatacacaagcagcggaacatattttacaa
gaaattagacaacaatag

DBGET integrated database retrieval system