KEGG   Sutterella sp. KGMB03119: FG381_02100Help
Entry
FG381_02100       CDS       T06027                                 

Definition
(GenBank) aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sutk  Sutterella sp. KGMB03119
Pathway
sutk00260  Glycine, serine and threonine metabolism
sutk01100  Metabolic pathways
sutk01110  Biosynthesis of secondary metabolites
sutk01120  Microbial metabolism in diverse environments
sutk01130  Biosynthesis of antibiotics
sutk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sutk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FG381_02100
Enzymes [BR:sutk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     FG381_02100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP TssR
Motif
Other DBs
NCBI-ProteinID: QDA53833
Position
complement(524720..525745)
Genome map
AA seq 341 aa AA seqDB search
MIRLACDYQEGCLPAILERLQETNLVSAPGYGDDEFSERARTLIREACKAPDARVYFLEG
GTQTNSIAIHAMLAGYEGVLAAETGHIAVHEAGAVEARGHKVITLPQKDGKITAGSIEKW
MEAFLRDPSKDHVVQPGMVYISQPTEFGTLYSLSELEAISASCRRHGLPLFIDGARMAYG
LASEANDASLADIARLADVFYIGGTKCGALIGEALVVTNPRLMKHFFTLQKQQGAVLAKG
RLLGINFEVLMSGGNYLKAGRHGVRLAQKIRAALIEKGYELFVDSRTNQIFAWLDDEDLK
RIGEKAAISIWERRDDGKTLCRFCTSWATREEDVDQVLSLL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgatccgtcttgcttgcgactatcaggaaggttgtcttccggcgattcttgaacgtctt
caggaaaccaatcttgtttccgcgccgggctatggcgatgatgagttttcagagcgggcc
cgcacgctcatccgcgaggcatgcaaggcgccggatgcccgcgtttattttctggaaggc
ggcacgcagaccaactccattgcgattcacgccatgcttgcgggctatgagggcgttctc
gcggcggagaccggccacattgccgttcatgaagcgggcgctgtagaggcgcgcggccac
aaggtgatcacgctgccgcaaaaggacgggaagattaccgcggggtcgattgaaaagtgg
atggaagcgttcctgcgcgatcccagcaaggatcatgtcgtgcagcccgggatggtctac
atctctcagcccactgaattcggcaccctttacagcctgagcgaactcgaagccatttcc
gcatcctgccgccggcacggtctgccgctcttcatcgacggcgcgcgcatggcctacggc
ctcgcctcagaggcgaacgacgcgtcgctcgccgacatcgcccgtctggccgacgtcttc
tatatcggaggaacgaagtgcggggcgctcatcggcgaggcgcttgtcgtcacgaatcct
cgtctcatgaagcatttcttcacgctacagaagcagcagggtgcggtgctcgcaaagggg
cggctcctcggtattaatttcgaagtcctcatgagcggcgggaactaccttaaggccggc
cgccacggcgtgcggctcgcgcagaaaatccgcgcggcattgatcgagaagggctacgaa
ctctttgtcgactcccgcacgaatcagatctttgcctggctggacgacgaggatctgaag
cgcatcggcgagaaggccgccatttccatctgggagcgccgcgacgacgggaagaccctc
tgccgcttctgcaccagctgggccacgcgcgaagaggatgtcgaccaggtgctttcgctc
ctttaa

DBGET integrated database retrieval system