KEGG   Sutterella sp. KGMB03119: FG381_08430Help
Entry
FG381_08430       CDS       T06027                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
sutk  Sutterella sp. KGMB03119
Pathway
sutk03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sutk00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    FG381_08430
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sutk03011]
    FG381_08430
Ribosome [BR:sutk03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    FG381_08430
  Bacteria
    FG381_08430
  Archaea
    FG381_08430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: QDA54969
Position
2020012..2020350
Genome map
AA seq 112 aa AA seqDB search
METTAKVRGVRLSAQKGRLVADLIRGQQVGKALAILEFTQKRAAGIIRKALESAIANAEH
NDGADIDTLYVKTIHVEKAATLRRFGARAKGRGTRINKQTSHIYITVGDGES
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgacagctaaagttcgtggcgttcgcctttccgcccagaaaggtcgcctcgtt
gctgacctcattcgcggccagcaggtgggcaaggctctcgcgattctggagttcacccag
aagcgtgcagccggcatcatccgcaaggcgctcgagagtgcgattgccaacgccgagcac
aatgatggtgctgacatcgatacgctctatgtgaagacgatccatgtggaaaaggctgct
acgctgcgccgcttcggcgcccgcgccaagggccgcggtacgcgcatcaacaagcagacg
agccacatctacatcaccgtcggcgacggcgaaagctaa

DBGET integrated database retrieval system