KEGG   Sutterella megalosphaeroides: SUTMEG_03850Help
Entry
SUTMEG_03850      CDS       T05697                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
sutt  Sutterella megalosphaeroides
Pathway
sutt00860  Porphyrin and chlorophyll metabolism
sutt01100  Metabolic pathways
sutt01110  Biosynthesis of secondary metabolites
sutt01120  Microbial metabolism in diverse environments
Module
sutt_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:sutt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SUTMEG_03850 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sutt01007]
    SUTMEG_03850 (hemL)
Enzymes [BR:sutt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     SUTMEG_03850 (hemL)
Amino acid related enzymes [BR:sutt01007]
 Aminotransferase (transaminase)
  Class III
   SUTMEG_03850 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 FIST
Motif
Other DBs
NCBI-ProteinID: BBF22494
UniProt: A0A2Z6I7Y5
Position
complement(421925..423205)
Genome map
AA seq 426 aa AA seqDB search
MDHNQELFDRAQKVIPGGVNSPVRAFRSVGGAPRFIERAKGPYMWDAEGKSYIDYVCSWG
PMILGHNNDDVVAAVKEAVERGISFGAATEAEIVIAEEIRKLVPAMEEVRLVSSGTEAGM
SAIRLARGYTGRDKIVKFEGCYHGHSDSLLVKAGSGLLTFGNPSSSGVPASVTEHTLVLE
YNNPQQLEEAFARYGDEIACVIVEAVAGNMNLVRATPEFIRTMRELCTKHGALLIVDEVM
TGFRVALGGAQSLYGVTPDITMLGKVIGGGMPVAAFGARADIMQKVAPCGPVYQAGTLSG
NPVAVACGMATLKQIQRPGFYDELSAQTSKLTAGLTEAAREAGVPFCADSVGGMFGIYFL
DEKPRGFADVMKADQARFGRWFHEMLELGCYFAPSTFEAGFVSITHTDDVIAKTVEAARE
AFAKVA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggatcacaatcaggaactcttcgaccgcgcgcagaaggtcatccccggcggcgtcaac
tcgcccgtgcgagccttccgttccgtgggcggcgccccgcgcttcattgaacgcgccaag
ggcccctacatgtgggacgccgaaggcaagtcctacatcgactacgtctgctcctggggt
ccgatgatcctcggccacaacaacgacgacgtcgtcgccgccgtcaaggaagccgtcgaa
cgcggcatctccttcggtgcggccacggaagccgaaatcgtcatcgccgaagaaatccgc
aagctcgtgcccgccatggaagaagttcgcctcgtgagctccggcaccgaagcgggcatg
tccgccattcgtctcgcccgcggctacacgggtcgcgacaagatcgtgaagttcgaaggg
tgctaccacggccactccgactccctcctcgtgaaggcgggttcgggccttctcaccttc
ggcaatccctcctcctcgggcgttcccgcttccgtcacggaacacacgctcgtgctcgaa
tacaacaacccgcagcagctcgaagaagccttcgcgcgttacggcgacgaaatcgcctgc
gtgatcgtcgaagccgtggcgggcaacatgaatctcgtgcgcgccacgcccgaattcatc
cgcacgatgcgcgaactctgcacgaagcacggggcgcttctcatcgtcgacgaagtgatg
acgggcttccgcgttgccctgggcggcgctcagtcgctctacggcgtcacccccgacatc
acgatgctcggcaaggtgatcggcggcggcatgcccgtggcggccttcggcgctcgcgcc
gacatcatgcagaaggtcgccccgtgcggccccgtctatcaggcgggcacgctctcgggc
aaccccgtcgccgtcgcctgcggcatggccacgctcaagcagatccagcgtccgggcttc
tacgacgaactctccgctcagacgagcaagctcacggccggcctcaccgaagccgcgcgc
gaagcgggcgttcccttctgcgccgacagcgtgggcggcatgttcgggatctacttcctc
gacgaaaagccccgcggctttgccgacgtcatgaaggccgaccaggcccgcttcggtcgt
tggttccatgaaatgctcgaactcggctgctacttcgctccctcgaccttcgaggcgggc
ttcgtctcgatcacgcacaccgatgacgtgatcgcaaagaccgtcgaggccgcgcgcgaa
gcgttcgccaaggtggcctaa

DBGET integrated database retrieval system