KEGG   Sutterella megalosphaeroides: SUTMEG_11520Help
Entry
SUTMEG_11520      CDS       T05697                                 

Definition
(GenBank) amino acid lyase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sutt  Sutterella megalosphaeroides
Pathway
sutt00260  Glycine, serine and threonine metabolism
sutt01100  Metabolic pathways
sutt01110  Biosynthesis of secondary metabolites
sutt01120  Microbial metabolism in diverse environments
sutt01130  Biosynthesis of antibiotics
sutt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sutt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SUTMEG_11520
Enzymes [BR:sutt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SUTMEG_11520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 SKI
Motif
Other DBs
NCBI-ProteinID: BBF23261
UniProt: A0A2Z6I9T2
Position
1417397..1418434
Genome map
AA seq 345 aa AA seqDB search
MLRFACDYQEGAIPEIIERLTATNLESTPGYGKDDYCEEARRLIREACGAPDAAVHFFVG
GTQTNSIVIHAMLAEYQGVISPASGHVTGHEAGAVESKGHKVLVVPQKDGKISGESVRAC
MRAYLADDSREHAVEPGLVYISHPTEHGTLYTKAELESIREACDEYGLPLFLDGARLGYG
LAAEGTDVTLADIAALTDVFYIGGTKCGALFGEAVVIRDPKRLPRFFTTMKQNGAVLAKG
RLLGLQFATLMENGTYERVCGHGVRLAQKLKQALVETGHTLFIDTPTNQIFVYLSAEEEK
TLSKDFSFAVWNRDENGRALCRFVTSWATTEEAIDTLIAALKKGC
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgattcgcgtgcgactaccaggaaggtgccattcccgaaatcatcgaacgtctc
accgccaccaatctcgagtcgacgccgggttacggcaaggacgactactgcgaagaagcc
cgccgcctcattcgcgaagcctgcggcgctccggatgcggccgtgcacttcttcgtgggc
ggcacccagacgaattcgatcgtgatccacgccatgctcgccgaataccagggcgtgatc
tcgcccgcctcgggccacgtcaccggccacgaagcgggtgccgtcgagtcgaagggccac
aaggtgctcgtcgtgccgcagaaggacgggaagatttcgggcgaatccgtgcgcgcgtgc
atgcgcgcttaccttgcggacgacagccgcgagcatgccgtcgaacctggcctcgtctac
atctcccacccgaccgaacacggaacactctacacaaaggccgaactcgaatcgatccgc
gaagcgtgcgacgaatacgggctgccgcttttcctcgacggtgcgcgtttgggctatggc
ctcgcggccgaaggcaccgacgtgacgctcgccgacattgccgcccttacggacgtcttc
tacatcggcggcacgaagtgcggcgcgctcttcggcgaagcggttgtgattcgcgatccg
aagcgcctgccgcggttcttcacgacgatgaagcaaaacggggcggtgctcgcgaagggc
cgtctcctggggcttcagttcgcgaccctcatggaaaacggcacctacgagcgcgtgtgc
ggtcacggggtgcgtcttgcgcagaagttgaagcaggcccttgtcgaaaccggtcacacg
ctctttatcgacactccgaccaaccagatcttcgtctacctctccgccgaagaagaaaag
accctctcgaaggacttctcctttgcagtctggaaccgcgacgagaacggtcgcgcgctc
tgccgcttcgtcacctcctgggcgacgacggaagaggcgatcgacacgttgattgcggca
ttgaagaaaggctgctga

DBGET integrated database retrieval system