KEGG   Staphylococcus aureus subsp. aureus M013 (CA-MRSA): M013TW_0333Help
Entry
M013TW_0333       CDS       T01744                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
suu  Staphylococcus aureus subsp. aureus M013 (CA-MRSA)
Pathway
suu00071  Fatty acid degradation
suu00072  Synthesis and degradation of ketone bodies
suu00280  Valine, leucine and isoleucine degradation
suu00310  Lysine degradation
suu00362  Benzoate degradation
suu00380  Tryptophan metabolism
suu00620  Pyruvate metabolism
suu00630  Glyoxylate and dicarboxylate metabolism
suu00640  Propanoate metabolism
suu00650  Butanoate metabolism
suu00900  Terpenoid backbone biosynthesis
suu01100  Metabolic pathways
suu01110  Biosynthesis of secondary metabolites
suu01120  Microbial metabolism in diverse environments
suu01130  Biosynthesis of antibiotics
suu01200  Carbon metabolism
suu01212  Fatty acid metabolism
suu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:suu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M013TW_0333
   00630 Glyoxylate and dicarboxylate metabolism
    M013TW_0333
   00640 Propanoate metabolism
    M013TW_0333
   00650 Butanoate metabolism
    M013TW_0333
  09103 Lipid metabolism
   00071 Fatty acid degradation
    M013TW_0333
   00072 Synthesis and degradation of ketone bodies
    M013TW_0333
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M013TW_0333
   00310 Lysine degradation
    M013TW_0333
   00380 Tryptophan metabolism
    M013TW_0333
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M013TW_0333
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M013TW_0333
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    M013TW_0333
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:suu04147]
    M013TW_0333
Enzymes [BR:suu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     M013TW_0333
Exosome [BR:suu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M013TW_0333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt BsuBI_PstI_RE
Motif
Other DBs
NCBI-ProteinID: AEV77425
Position
380411..381592
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEINEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
NSQQKAVRAQQNGEFDSEIVPVSIPQRKGESIVVTMDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
LKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattaatgaagtcatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaacagtacct
gcatttacagtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcaa
tcaccaatgcttgtcaacaacagtcgctttggttttaaaatgggacatcaatcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagtagaacaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacaaaaagcagtacgtgcacagcaaaatggtgaatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaatcaatcgttgtcactatggatgaaggtgta
cgtgaaaatgtatcagttgaaaaattaagtcgcttaagaccagctttcaaaaaagacggt
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggtgtagatccttctattatgggtattgcaccagttggcgctgttgaaaaggct
ttgaaacgtagtaaaaaagaattaagcgatattgatgtatttgaattaaatgaagcattt
gcagcacaatcattagctgtagatcgcgaattaaaattacctcctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacaccctattggtgcatctggtgctagagttttagtg
acattattgcatcaactgaatgatgaagtcgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaagtataaataa

DBGET integrated database retrieval system