KEGG   Staphylococcus aureus subsp. aureus M013 (CA-MRSA): M013TW_0594Help
Entry
M013TW_0594       CDS       T01744                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
suu  Staphylococcus aureus subsp. aureus M013 (CA-MRSA)
Pathway
suu00010  Glycolysis / Gluconeogenesis
suu00071  Fatty acid degradation
suu00350  Tyrosine metabolism
suu00625  Chloroalkane and chloroalkene degradation
suu00626  Naphthalene degradation
suu01100  Metabolic pathways
suu01110  Biosynthesis of secondary metabolites
suu01120  Microbial metabolism in diverse environments
suu01130  Biosynthesis of antibiotics
suu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:suu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M013TW_0594
  Lipid metabolism
   00071 Fatty acid degradation
    M013TW_0594
  Amino acid metabolism
   00350 Tyrosine metabolism
    M013TW_0594
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    M013TW_0594
   00626 Naphthalene degradation
    M013TW_0594
Enzymes [BR:suu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     M013TW_0594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C BKACE Methyltransf_11 ADH_N_2 Methyltransf_25 NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: AEV77666
Position
649675..650685
Genome map
AA seq 336 aa AA seqDB search
MRAAVVTKDHKVSIEDKKLRALKPGEALVQTEYCGVCHTDLHVKNADFGDVTGVTLGHEG
IGKVIEVAEDVESLKIGDRVSIAWMFESCGRCEYCTTGRETLCRSVKNAGYTVDGAMAEQ
VIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVKVSNVKPGQWLGVFGIGGLGNLALQY
AKNVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDPVAEVMKLTDNKGLDATVVTSVA
KTPFNQAVDVVKAGARVVAVGLPVDKMNLDIPRLVLDGIEVVGSLVGTRQDLREAFEFAA
ENKVTPKVQLRKLEEINDIFEEMENGTITGRMVIKF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagcagttgtaacgaaagatcacaaagtaagtattgaggacaaaaagttaaga
gctttaaaacctggtgaagcattggtacaaacggaatattgtggtgtttgtcataccgat
ttacatgttaagaatgctgattttggtgatgttacaggcgttactttaggtcatgaaggt
attggtaaagtcatcgaagttgcagaagatgtagaatcattaaaaattggagaccgtgtg
tctatcgcttggatgttcgaaagctgtggaagatgtgaatattgtacaacaggtcgtgaa
acactttgccgtagtgtgaaaaatgctggttatacagtagatggtgcaatggctgaacaa
gttattgttactgcagactatgctgtgaaagtacctgaaaaattagatccagcagcagcg
tcttctattacatgcgcaggtgtgacaacttataaagctgtaaaagtaagtaatgtaaaa
cctggacaatggttaggtgtttttggtataggtggtttaggaaacctagctttacaatat
gctaaaaacgttatgggggctaaaattgttgccttcgatattaatgatgataaattagca
ttcgcgaaagaattaggtgcagatgctattattaattctaaagatgttgatccagttgca
gaagttatgaaattaactgataacaaaggattagatgcaacagtggtaacttcagttgct
aagacgccatttaaccaagcggttgatgttgtaaaagctggtgcaagagttgttgctgtt
ggtttacctgttgataaaatgaacttagatatcccaagattagtgcttgatggtattgaa
gtagtaggttcacttgttggtacaagacaagacttacgtgaagcgtttgaatttgctgct
gaaaataaagtaacacctaaagttcaattaagaaaattagaagaaatcaatgatattttt
gaagaaatggaaaatggtactataactggtagaatggttattaaattttaa

DBGET integrated database retrieval system