KEGG   Staphylococcus aureus subsp. aureus M013 (CA-MRSA): M013TW_2377Help
Entry
M013TW_2377       CDS       T01744                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
suu  Staphylococcus aureus subsp. aureus M013 (CA-MRSA)
Pathway
suu00010  Glycolysis / Gluconeogenesis
suu00260  Glycine, serine and threonine metabolism
suu00680  Methane metabolism
suu01100  Metabolic pathways
suu01110  Biosynthesis of secondary metabolites
suu01120  Microbial metabolism in diverse environments
suu01130  Biosynthesis of antibiotics
suu01200  Carbon metabolism
suu01230  Biosynthesis of amino acids
Module
suu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
suu_M00002  Glycolysis, core module involving three-carbon compounds
suu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:suu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M013TW_2377
  Energy metabolism
   00680 Methane metabolism
    M013TW_2377
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M013TW_2377
Enzymes [BR:suu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     M013TW_2377
Membrane trafficking [BR:suu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    M013TW_2377
Exosome [BR:suu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   M013TW_2377
  Exosomal proteins of melanoma cells
   M013TW_2377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEV79369
Position
complement(2438498..2439184)
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTR
ALDTTHYILTESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVK
PPAETEEQREAYLADRRYNHLDKRMMPYSESLKDTLVRVIPFWTDHISQYLLDGQTVLVS
AHGNSIRALIKYLEDVSDEDIINYEIKTGAPLVYELTDDLEVIDKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattaattttatgtcgtcatggacaaagcgagtggaatgctaaaaacttattt
actggatgggaagatgttaatttatctgaacaaggtattaatgaagcgactagagcaggt
gaaaaagtaagagaaaataacattgccatcgatgtagcttttacatctttattaacacgt
gctttagatacaacgcattatattttaactgaatctaaacaacaatggattcctgtatat
aaaagctggcgtttaaatgagcgtcactatggtggattgcaaggcttaaataaagatgat
gctagaaaagaatttggagaagaacaagtacatatttggcgtcgttcttatgatgtgaaa
ccacctgctgaaaccgaagaacaacgtgaagcttacttagctgatcgtagatataatcat
ttagataaacgtatgatgccttattctgaaagtctgaaagatactttagttcgagtgata
ccattttggacagatcatatttcacaatatttgctagatggtcaaacggtattagtttct
gcacacggaaattcaattcgcgcattgattaaatatcttgaagatgtgtcagatgaagat
atcattaattatgaaattaaaacaggtgcaccacttgtttatgaattaacggatgattta
gaagttatagataaatactacttataa

DBGET integrated database retrieval system