KEGG   Staphylococcus aureus subsp. aureus VC40: SAVC_01520Help
Entry
SAVC_01520        CDS       T01745                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
suv  Staphylococcus aureus subsp. aureus VC40
Pathway
suv00071  Fatty acid degradation
suv00072  Synthesis and degradation of ketone bodies
suv00280  Valine, leucine and isoleucine degradation
suv00310  Lysine degradation
suv00362  Benzoate degradation
suv00380  Tryptophan metabolism
suv00620  Pyruvate metabolism
suv00630  Glyoxylate and dicarboxylate metabolism
suv00640  Propanoate metabolism
suv00650  Butanoate metabolism
suv00900  Terpenoid backbone biosynthesis
suv01100  Metabolic pathways
suv01110  Biosynthesis of secondary metabolites
suv01120  Microbial metabolism in diverse environments
suv01130  Biosynthesis of antibiotics
suv01200  Carbon metabolism
suv01212  Fatty acid metabolism
suv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:suv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAVC_01520
   00630 Glyoxylate and dicarboxylate metabolism
    SAVC_01520
   00640 Propanoate metabolism
    SAVC_01520
   00650 Butanoate metabolism
    SAVC_01520
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVC_01520
   00072 Synthesis and degradation of ketone bodies
    SAVC_01520
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVC_01520
   00310 Lysine degradation
    SAVC_01520
   00380 Tryptophan metabolism
    SAVC_01520
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAVC_01520
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVC_01520
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAVC_01520
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:suv04147]
    SAVC_01520
Enzymes [BR:suv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAVC_01520
Exosome [BR:suv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAVC_01520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: AEZ36470
Position
347864..349045
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEIDEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
NSQQKAVRAQQNGEFDSEIVPVSIPQRKGEPIVVTKDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
LKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattgatgaagttatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaacagtacct
gcatttacggtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcaa
tcaccaatgcttgtcaacaacagtcgctttggttttaaaatgggacatcaatcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagtagagcaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacaaaaagcagtacgtgcacagcaaaatggtgaatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaaccaatcgtagtcactaaggatgaaggtgta
cgtgaaaatgtatcagtcgaaaaattaagtcgattaagaccagctttcaaaaaagacggt
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggtgtagatccttctattatgggtattgcaccagttggcgctgtagaaaaggct
ttgaaacgtagtaaaaaagaattaagcgatattgatgtatttgaattaaatgaagcattt
gcagcacaatcattagctgttgatcgtgaattaaaattacctcctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacatcctattggtgcatctggtgctagagtattagtg
acattattgcatcaactgaatgatgaagttgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaagtataaataa

DBGET integrated database retrieval system