KEGG   Staphylococcus aureus subsp. aureus VC40: SAVC_07550Help
Entry
SAVC_07550        CDS       T01745                                 

Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
suv  Staphylococcus aureus subsp. aureus VC40
Pathway
suv00860  Porphyrin and chlorophyll metabolism
suv01100  Metabolic pathways
suv01110  Biosynthesis of secondary metabolites
suv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:suv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SAVC_07550
Enzymes [BR:suv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SAVC_07550
Exosome [BR:suv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAVC_07550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD HMA
Motif
Other DBs
NCBI-ProteinID: AEZ37669
Position
complement(1629724..1630698)
Genome map
AA seq 324 aa AA seqDB search
MKFDRHRRLRSSATMRDMVRENHVRKEDLIYPIFVVEKDDVKKEIKSLPGVYQISLNLLE
SELKEAYDLGIRAIMFFGVPNSKDDIGTGAYIHDGVIQQATRIAKKMYDDLLIVADTCLC
EYTDHGHCGVIDDHTHDVDNDKSLPLLVKTAISQVEAGADIIAPSNMMDGFVAEIRRGLD
EAGYYNIPIMSYGVKYASSFFGPFRDAADSAPSFGDRKTYQMDPANRLEALRELESDLKE
GCDMMIVKPALSYLDIVRDVKNHTNVPVVAYNVSGEYSMTKAAAQNGWIDEERVVMEQMV
SMKRAGADMIITYFAKDICRYLDK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgatagacatagaagattgagatcatcagcgacaatgagagatatggttaga
gagaatcatgtaagaaaagaagatttaatatatccaatttttgtagttgaaaaagacgat
gtgaaaaaagaaattaagtcattgccaggtgtataccaaatcagtttgaatttacttgaa
agtgaattaaaagaagcttatgacttaggcatacgtgccattatgtttttcggtgttcca
aactcaaaagatgatataggtactggtgcatacattcacgatggtgttattcaacaggca
acacgtattgctaaaaaaatgtatgatgacttattaattgttgcagacacttgtttatgt
gaatatactgatcatggtcattgtggcgtgattgatgaccatacacatgacgttgacaat
gataaatcattgccactacttgttaaaacagcaatttctcaagtggaagctggtgctgat
attattgcgccaagtaatatgatggatggttttgttgctgaaattcgtcgtggattagat
gaagccggctattacaatattcctataatgagttatggtgtcaagtatgcatcaagtttc
tttggaccttttagagatgcagcagattcagcgccatcatttggggatagaaaaacgtat
cagatggaccctgctaaccgtttggaagcacttcgtgaattagaaagtgatcttaaagaa
gggtgcgacatgatgattgttaaacctgctctaagttatttagatatagttcgagatgtt
aaaaatcatacgaatgttccagttgttgcatataatgtgagtggagaatatagtatgact
aaagcagcggcacaaaatggttggatagatgaagaacgtgtcgttatggaacaaatggtt
tcaatgaaacgtgcaggtgctgatatgattattacgtattttgcaaaggacatttgtcgc
tatttagataaataa

DBGET integrated database retrieval system