KEGG   Staphylococcus aureus subsp. aureus VC40: SAVC_11650Help
Entry
SAVC_11650        CDS       T01745                                 

Definition
(GenBank) 1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
suv  Staphylococcus aureus subsp. aureus VC40
Pathway
suv00250  Alanine, aspartate and glutamate metabolism
suv00330  Arginine and proline metabolism
suv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:suv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAVC_11650
   00330 Arginine and proline metabolism
    SAVC_11650
Enzymes [BR:suv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     SAVC_11650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEZ38475
Position
complement(2513388..2514932)
Genome map
AA seq 514 aa AA seqDB search
MVVEFKNEPGYDFSVQENVDMFKKALKDVEKELGQDIPLVINGEKIFKDDKIKSINPADT
SQVIANASKATKQDVEDAFKAANEAYKSWKTWSANDRAELMLRVSAIIRRRKAEIAAIMV
YEAGKPWDEAVGDAAEGIDFIEYYARSMMDLAQGKPVLDREGEHNKYFYKSIGTGVTIPP
WNFPFAIMAGTTLAPVVAGNTVLLKPAEDTPYIAYKLMEILEEAGLPKGVVNFVPGDPKE
IGDYLVDHKDTHFVTFTGSRATGTRIYERSAVVQEGQNFLKRVIAEMGGKDAIVVDENID
TDMAAEAIVTSAFGFSGQKCSACSRAIVHKDVYDEVLEKSIKLTKELTLGNTVDNTYMGP
VINKKQFDKIKNYIEIGKEEGKLEQGGGTDDSKGYFVEPTIISGLKSKDRIMQEEIFGPV
VGFVKVNDFDEAIEVANDTDYGLTGAVITNNREHWIKAVNEFDVGNLYLNRGCTSAVVGY
HPFGGFKMSGTDAKTGSPDYLLHFLEQKVVSEMF
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggtagtagaatttaaaaatgaacctggttacgatttttcagtccaagaaaatgtggat
atgtttaagaaagcattgaaagacgtggaaaaagaattaggtcaagacataccattagtg
attaatggagagaagattttcaaagatgacaaaattaaatcaatcaatcctgcagacaca
tcacaagtgattgcaaatgcatcaaaggcaacaaaacaagatgttgaagatgcgtttaaa
gcagcaaacgaagcttataaatcttggaaaacatggtcagcaaatgatcgtgcagagctt
atgttacgtgtttcggcaattattcgtcgtcgaaaagcggaaattgcagcaattatggtt
tatgaagcaggtaagccatgggatgaagcagttggtgatgcagctgaaggtattgatttt
attgaatactatgcacgttcaatgatggacttggctcaaggtaagccagtacttgatcgt
gaaggtgaacacaataaatatttctataaatcaattggtacaggtgttacaattccgccg
tggaacttcccgtttgcgattatggctggtacaactttagcaccagttgtggcaggtaat
acagtgttattgaaacctgctgaggatacaccttatatcgcttataaattaatggaaatt
ttagaagaagcaggattaccaaaaggcgtagttaactttgttcctggtgatccgaaagaa
attggtgattacttagttgatcataaagatacgcatttcgttacatttacaggatcacgt
gcgacaggtactagaatttatgaacgtagtgccgttgttcaagaaggtcaaaacttcttg
aaacgtgttatcgctgaaatgggtggtaaagatgccattgtagttgatgaaaatattgat
acagatatggcagcagaagctattgtaacgtcagcatttggtttttctggtcaaaaatgt
tcagcatgttcacgtgcaattgtgcataaagacgtttatgacgaagtattagagaaatca
atcaaattaacaaaagaattaacgttgggcaatactgtagacaatacgtatatgggccca
gttattaataaaaaacaatttgataagattaaaaattatattgagattggtaaagaagaa
ggtaaattagaacaaggtggcggcactgatgattcaaaaggttactttgtagaaccaaca
atcatttcaggacttaaatctaaagatagaatcatgcaagaagaaatttttggtccagtt
gttggctttgtgaaagttaacgattttgatgaagcaattgaggttgcaaatgatacagat
tacggtttaactggtgcagtgattacaaataatcgcgagcattggattaaagcggtaaac
gaatttgatgtaggcaatttataccttaacagaggctgtacttcagcagttgttggatac
catccatttggtggtttcaaaatgtcaggtacggacgctaaaacaggtagtccagactac
ttattacacttcttagaacaaaaggttgtttcagaaatgttctaa

DBGET integrated database retrieval system