KEGG   Staphylococcus aureus subsp. aureus VC40: SAVC_11905Help
Entry
SAVC_11905        CDS       T01745                                 

Definition
(GenBank) hypothetical protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
suv  Staphylococcus aureus subsp. aureus VC40
Pathway
suv00010  Glycolysis / Gluconeogenesis
suv00620  Pyruvate metabolism
suv00640  Propanoate metabolism
suv00680  Methane metabolism
suv01100  Metabolic pathways
suv01110  Biosynthesis of secondary metabolites
suv01120  Microbial metabolism in diverse environments
suv01130  Biosynthesis of antibiotics
suv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:suv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVC_11905
   00620 Pyruvate metabolism
    SAVC_11905
   00640 Propanoate metabolism
    SAVC_11905
  Energy metabolism
   00680 Methane metabolism
    SAVC_11905
Enzymes [BR:suv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SAVC_11905
Lipid biosynthesis proteins [BR:suv01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SAVC_11905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Atu4866
Motif
Other DBs
NCBI-ProteinID: AEZ38525
Position
complement(2566128..2567726)
Genome map
AA seq 532 aa AA seqDB search
MQKSALFAPEKYNIISEIEKYSHIPDKKAILYHNTEGEDISVTYQQLIEQSNKVGNVLAS
HGLSKGDKVLIMMPRSIATYELYIAALKLGVAIIPCSEMLRTKDLQYRITHGEINAVIAL
EPFTVEFEKIKEYDALTKFVIAGQKDGWISLEAEKENASNKLEMADTTRDDMAILSYTSG
TTGNPKAVTHCHGWGFAHLQMAPKHWLCINEDDLVWATAAPGWQKWVWSPFLSVLGSGAT
AFVFNGRFSPETYLELLQKYQINVLCCTPTEYRMMAKLQNLNDYDLTHLHSAVSAGEPLN
REVVEQFKKYFNLTVRDGYGQTESTLLIGFLKDTPQRIGSMGKGIPGSSVTVVDDEGNSV
PANTKGNIAVPLDLPALFKGYYKEPERTAKAQTGKYYITGDLAHVDDDGYFWFEGRRDDI
IISSGYTIGPFEVEDALTNHPAVKECAVVAKPHDIRGNIVKAFVILQDHTAGDDTLVKEL
QQFVKNEVAPYKYPREIEFVDDLPKTNSGKIRRVELRDAEIEKWQQQKDSNQ
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagtcagctctattcgcgcctgaaaaatataacattatttcggaaatcgaaaaa
tatagccacataccagataaaaaggcaattttatatcataatactgaaggcgaagatata
tcagtcacttaccaacagctcattgaacagtctaataaagtaggtaatgttttagcatcg
cacggtttatctaaaggcgataaagtactcattatgatgccacgatctattgcgacgtat
gaattatatattgctgctttaaaattaggtgttgcaatcattccatgttctgaaatgcta
agaactaaagatttacaataccgtatcacacatggtgaaattaatgcagttattgcacta
gagccattcacagttgaatttgaaaaaattaaagaatatgatgcgttaactaaatttgtt
attgccggtcaaaaagatggatggatttcacttgaagctgaaaaagaaaacgcaagtaac
aaactagaaatggcagatacgacgcgtgatgatatggcgattctgtcatatacatctggt
acaactggcaatcctaaagccgttacacattgtcatggatggggatttgcacatttacaa
atggcaccaaaacattggttatgtattaatgaagatgacttagtttgggcaacagcagca
ccaggttggcaaaaatgggtatggagtcctttcttatctgtattaggttcaggtgcaact
gcttttgtatttaatggaaggttcagtcctgaaacatacttagaattgcttcaaaaatat
caaattaatgttttatgttgtacaccgacagaatatcgtatgatggctaaattacagaac
ttaaatgattatgacttaacgcatttacatagtgccgtttctgcaggtgagccactaaat
cgagaagtagttgaacaattcaagaaatactttaatttaactgtaagagatggatatggc
cagactgaaagtaccttgcttataggctttttaaaagatacaccacagaggattggatca
atgggtaaaggcattccgggtagttcggtcactgtagtagatgatgaggggaatagcgta
cctgctaatacgaaagggaatattgcagtaccacttgatttgccagcacttttcaaaggg
tattataaagagccagaacgtacggcgaaagcgcaaacaggtaaatactacatcactggt
gacttagctcatgtagatgatgatggttatttctggtttgaaggacgtcgagatgacatt
attattagttcaggctatacgattgggccttttgaagttgaagatgcgttaacgaatcat
ccagccgttaaagaatgtgctgtagtagcaaaacctcatgatatacgaggaaatattgtt
aaagcattcgttattttacaggaccatactgcgggtgatgatacgttagttaaagaacta
caacaatttgttaaaaatgaagttgcaccatataaatatccgagagagattgaattcgtt
gacgacttaccaaaaacaaactcaggtaaaattcgtcgtgttgaactacgagatgctgaa
atagaaaaatggcaacaacaaaaagatagcaatcaataa

DBGET integrated database retrieval system