KEGG   Staphylococcus aureus subsp. aureus TW20 (MRSA): SATW20_04220Help
Entry
SATW20_04220      CDS       T02060                                 

Gene name
thl
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
suw  Staphylococcus aureus subsp. aureus TW20 (MRSA)
Pathway
suw00071  Fatty acid degradation
suw00072  Synthesis and degradation of ketone bodies
suw00280  Valine, leucine and isoleucine degradation
suw00310  Lysine degradation
suw00362  Benzoate degradation
suw00380  Tryptophan metabolism
suw00620  Pyruvate metabolism
suw00630  Glyoxylate and dicarboxylate metabolism
suw00640  Propanoate metabolism
suw00650  Butanoate metabolism
suw00900  Terpenoid backbone biosynthesis
suw01100  Metabolic pathways
suw01110  Biosynthesis of secondary metabolites
suw01120  Microbial metabolism in diverse environments
suw01130  Biosynthesis of antibiotics
suw01200  Carbon metabolism
suw01212  Fatty acid metabolism
suw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:suw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SATW20_04220 (thl)
   00630 Glyoxylate and dicarboxylate metabolism
    SATW20_04220 (thl)
   00640 Propanoate metabolism
    SATW20_04220 (thl)
   00650 Butanoate metabolism
    SATW20_04220 (thl)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SATW20_04220 (thl)
   00072 Synthesis and degradation of ketone bodies
    SATW20_04220 (thl)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SATW20_04220 (thl)
   00310 Lysine degradation
    SATW20_04220 (thl)
   00380 Tryptophan metabolism
    SATW20_04220 (thl)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SATW20_04220 (thl)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SATW20_04220 (thl)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SATW20_04220 (thl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:suw04147]
    SATW20_04220 (thl)
Enzymes [BR:suw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SATW20_04220 (thl)
Exosome [BR:suw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SATW20_04220 (thl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: CBI48306
Position
451360..452541
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEIDEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
NSQQKAVRAQQNGEFDSEIVPVSIPQRKGEPIVVTKDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
LKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattgatgaagttatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaacagtacct
gcatttacggtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcaa
tcaccaatgcttgtcaacaacagtcgctttggttttaaaatgggacatcaatcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagtagagcaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacaaaaagcagtacgtgcacagcaaaatggtgaatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaaccaatcgtagtcactaaggatgaaggtgta
cgtgaaaatgtatcagtcgaaaaattaagtcgattaagaccagctttcaaaaaagacggt
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggtgtagatccttctattatgggtattgcaccagttggcgctgtagaaaaggct
ttgaaacgtagtaaaaaagaattaagcgatattgatgtatttgaattaaatgaagcattt
gcagcacaatcattagctgttgatcgtgaattaaaattacctcctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacatcctattggtgcatctggtgctagagtattagtg
acattattgcatcaactgaatgatgaagttgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaagtataaataa

DBGET integrated database retrieval system