KEGG   Staphylococcus aureus subsp. aureus TW20 (MRSA): SATW20_05820Help
Entry
SATW20_05820      CDS       T02060                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
suw  Staphylococcus aureus subsp. aureus TW20 (MRSA)
Pathway
suw00790  Folate biosynthesis
suw01100  Metabolic pathways
Module
suw_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:suw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SATW20_05820 (folP)
Enzymes [BR:suw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SATW20_05820 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind Pox_P35
Motif
Other DBs
NCBI-ProteinID: CBI48461
Structure
PDB: 

Position
622068..622877
Genome map
AA seq 269 aa AA seqDB search
MTKTKIMGILNVTPDSLSDGGKFNNVESAINRVKAMIDEGADIIDVGGVSTRPGHEMVSL
EEEMNRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDMINDQWAGLYDHRMFQIVAK
YDAEIILMHNGNGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNEEA
EVMARLDELVATEYPVLLATSRKRFTKEMMGYDTTPVERDEVTAATTAYGIMKGVRAVRV
HNVELNAKLAKGIDFLKEKENENARHNLS
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacaaaaattatgggcatattaaacgtcacacctgattcactctcagatggt
ggaaaatttaataatgttgaatcagctataaatagagtgaaagccatgatagatgaaggt
gctgacattatagatgttggaggtgtttcaacgagacccggtcatgaaatggtttcatta
gaagaagagatgaacagagtattacctgttgttgaagctattgtcggttttgatgtaaaa
atttcagtcgatacatttcgaagtgaggttgctgaagcatgtttaaaattaggcgttgat
atgattaatgatcaatgggcgggtctgtatgatcatcgtatgttccaaattgtagctaaa
tatgacgcggaaattattttaatgcataatggaaatggtaatcgtgatgaaccggttgtc
gaagaaatgttaacatctttgttagcacaagcacatcaagctaaaatagctggtatacct
tcaaataaaatttggctagatccaggtataggtttcgctaaaactagaaatgaagaagcc
gaagttatggcaagactggatgaacttgttgcaacagaatatccagttttattagcgaca
agccggaaacgtttcactaaagagatgatgggttatgatacaacaccggttgaaagagat
gaagtaactgcagctacgactgcatatggtattatgaaaggcgttagagcagtacgcgtt
cataatgtcgagttgaatgctaaattagctaaaggtatagattttttaaaggagaaggag
aatgaaaatgcaagacacaatctttcttaa

DBGET integrated database retrieval system