KEGG   Staphylococcus aureus subsp. aureus HO 5096 0412: SAEMRSA15_03090Help
Entry
SAEMRSA15_03090   CDS       T02059                                 

Gene name
thl
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sux  Staphylococcus aureus subsp. aureus HO 5096 0412
Pathway
sux00071  Fatty acid degradation
sux00072  Synthesis and degradation of ketone bodies
sux00280  Valine, leucine and isoleucine degradation
sux00310  Lysine degradation
sux00362  Benzoate degradation
sux00380  Tryptophan metabolism
sux00620  Pyruvate metabolism
sux00630  Glyoxylate and dicarboxylate metabolism
sux00640  Propanoate metabolism
sux00650  Butanoate metabolism
sux00900  Terpenoid backbone biosynthesis
sux01100  Metabolic pathways
sux01110  Biosynthesis of secondary metabolites
sux01120  Microbial metabolism in diverse environments
sux01130  Biosynthesis of antibiotics
sux01200  Carbon metabolism
sux01212  Fatty acid metabolism
sux02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sux00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAEMRSA15_03090 (thl)
   00630 Glyoxylate and dicarboxylate metabolism
    SAEMRSA15_03090 (thl)
   00640 Propanoate metabolism
    SAEMRSA15_03090 (thl)
   00650 Butanoate metabolism
    SAEMRSA15_03090 (thl)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAEMRSA15_03090 (thl)
   00072 Synthesis and degradation of ketone bodies
    SAEMRSA15_03090 (thl)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAEMRSA15_03090 (thl)
   00310 Lysine degradation
    SAEMRSA15_03090 (thl)
   00380 Tryptophan metabolism
    SAEMRSA15_03090 (thl)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAEMRSA15_03090 (thl)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAEMRSA15_03090 (thl)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAEMRSA15_03090 (thl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sux04147]
    SAEMRSA15_03090 (thl)
Enzymes [BR:sux01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAEMRSA15_03090 (thl)
Exosome [BR:sux04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAEMRSA15_03090 (thl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: CCG15027
Position
372687..373868
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEIDEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
NSQQKAVRAQQNGEFDSEIVPVSIPQRKGEPIVVTKDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
LKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattgatgaagttatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttaccagagacagtacct
gcatttacagtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcaa
tcaccaatgcttgtcaacaacagtcgctttggttttaaaatgggacatcaatcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagtagagcaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacaaaaagcagtacgtgcacagcaaaatggtgaatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaaccaatcgttgtcactaaggatgaaggtgta
cgtgaaaatgtatcagtcgaaaaattaagtcgcttaagaccagctttcaaaaaagacggt
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggtgtagatccttctattatgggtattgcaccagttggcgctgttgaaaaggct
ttgaaacgtagtaaaaaagaattaagcgatattgatgtatttgaattaaatgaagcattt
gcagcacaatcattagctgtagatcgcgaattaaaattacctcctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacaccctattggtgcatctggtgctagagtattagtg
acattattgcatcaactgaatgatgaagttgaaactggtttaacgtcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaagtataaataa

DBGET integrated database retrieval system