KEGG   Staphylococcus aureus subsp. aureus HO 5096 0412: SAEMRSA15_03290Help
Entry
SAEMRSA15_03290   CDS       T02059                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sux  Staphylococcus aureus subsp. aureus HO 5096 0412
Pathway
sux00010  Glycolysis / Gluconeogenesis
sux00260  Glycine, serine and threonine metabolism
sux00680  Methane metabolism
sux01100  Metabolic pathways
sux01110  Biosynthesis of secondary metabolites
sux01120  Microbial metabolism in diverse environments
sux01130  Biosynthesis of antibiotics
sux01200  Carbon metabolism
sux01230  Biosynthesis of amino acids
Module
sux_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sux_M00002  Glycolysis, core module involving three-carbon compounds
sux_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sux00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAEMRSA15_03290
  Energy metabolism
   00680 Methane metabolism
    SAEMRSA15_03290
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAEMRSA15_03290
Enzymes [BR:sux01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SAEMRSA15_03290
Membrane trafficking [BR:sux04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SAEMRSA15_03290
Exosome [BR:sux04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SAEMRSA15_03290
  Exosomal proteins of melanoma cells
   SAEMRSA15_03290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CCG15047
Position
392210..392791
Genome map
AA seq 193 aa AA seqDB search
MTIYLVRHGESQSNYDNKHFRSYFCGQLDVPLTDFGKKSADDLCDYFKEKQIKHVYVSDL
LRTQQTFEHIFPYDIASTTTPLLRERSLGVFEGEYKDEISANPKYEKYFNDPNFKDFRHS
FSQKAPEGESYEDVYQRVEHFMNHVVNEDTQKDDIVIVAHQVVIRCLMVYFNNVSREEAV
DLKVENCKPYIIE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgacgatttatttagttagacatggcgaatcacaatcgaattatgataataaacatttt
cgatcttatttttgtggacaattagatgtgccgttaacggattttggtaagaaaagtgca
gacgatttatgtgattattttaaagagaaacagattaaacatgtatatgtttcagactta
ttaaggacacagcaaacgtttgaacatatttttccatatgacattgcatcaacgactacg
cctctattaagagaacgttcgcttggcgtatttgagggtgaatataaagatgaaatcagt
gcgaatccgaaatatgaaaaatatttcaatgatccaaactttaaagactttcgtcatagt
ttttcacaaaaagcgcctgaaggagaaagttatgaagatgtatatcaacgcgtcgaacat
tttatgaatcatgttgtcaatgaagatacacaaaaagatgatatcgtcattgttgcacat
caagttgtcattcgttgtttaatggtttattttaataacgtttcacgggaagaagctgtg
gatttaaaagttgaaaattgcaaaccatatatcattgaatag

DBGET integrated database retrieval system