KEGG   Staphylococcus aureus subsp. aureus HO 5096 0412: SAEMRSA15_09250Help
Entry
SAEMRSA15_09250   CDS       T02059                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sux  Staphylococcus aureus subsp. aureus HO 5096 0412
Pathway
sux00010  Glycolysis / Gluconeogenesis
sux00020  Citrate cycle (TCA cycle)
sux00620  Pyruvate metabolism
sux01100  Metabolic pathways
sux01110  Biosynthesis of secondary metabolites
sux01120  Microbial metabolism in diverse environments
sux01130  Biosynthesis of antibiotics
sux01200  Carbon metabolism
Module
sux_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sux00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAEMRSA15_09250 (pdhC)
   00020 Citrate cycle (TCA cycle)
    SAEMRSA15_09250 (pdhC)
   00620 Pyruvate metabolism
    SAEMRSA15_09250 (pdhC)
Enzymes [BR:sux01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SAEMRSA15_09250 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_3 ATP-synt_ab_Xtn HlyD_D23 DUF896 DUF2090 HTH_17 NRIP1_repr_3
Motif
Other DBs
NCBI-ProteinID: CCG15640
Position
1042143..1043435
Genome map
AA seq 430 aa AA seqDB search
MAFEFRLPDIGEGIHEGEIVKWFVKAGDTIEEDDVLAEVQNDKSVVEIPSPVSGTVEEVM
VEEGTVAVVGDVIVKIDAPDAEDMQFKGHDDDSSSKEEPAKEEAPAEQAPVATQTEEVDE
NRTVKAMPSVRKYAREKGVNIKAVSGSGKNGRITKEDVDAYLNGGAPTASNESAASTTSE
EVAETPAAPAAVSLEGDFPETTEKIPAMRRAIAKAMVNSKHTAPHVTLMDEIDVQALWDH
RKKFKEIAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEIVHKHYWNIGIAADT
DRGLLVPVVKHADRKSIFQISDEINELAVKARDGKLTADEMKGATCTISNIGSAGGQWFT
PVINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHIKRLL
NNPELLLMEG
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttagattacccgatatcggggaaggtatccacgaaggtgaaattgta
aaatggtttgttaaagctggagatactattgaagaagacgatgttttagctgaggtacaa
aacgataaatcagtagtagaaatcccatcaccagtatctggtactgttgaagaagttatg
gtagaagaaggtacagtagctgtagttggtgacgttattgttaaaatcgatgcacctgat
gcagaagatatgcaatttaaaggtcatgatgatgattcatcatctaaagaagaacctgcg
aaagaggaagcgccagcagagcaagcacctgtagctactcaaactgaagaagtagatgaa
aacagaactgttaaagcaatgccttcagtacgtaaatacgcacgtgaaaaaggtgttaac
attaaagcagtttcaggatctggtaaaaatggtcgtattacaaaagaagatgtagatgca
tacttaaatggtggtgcaccaacagcttcaaatgaatcagctgcttcaactacaagtgaa
gaagttgctgaaactcctgcagcacctgcagcagtatcattagaaggcgacttcccagaa
acaactgaaaaaatccctgctatgcgtagagcaattgcgaaagcaatggttaactctaag
catactgcacctcatgtaacattaatggatgaaattgatgttcaagcattatgggatcac
cgtaagaaatttaaagaaatcgcagctgaacaaggtactaagttaacattcttaccatat
gttgttaaagcgcttgtttctgcattgaaaaaatacccagcacttaatacttcattcaat
gaagaagctggtgaaattgtgcataaacattactggaatatcggtattgcggcggacact
gatagaggtttattagtacctgtagtgaaacatgctgaccgtaaatctattttccaaatt
tctgatgaaattaatgaattagctgttaaagcacgtgatggtaaattaacagccgatgaa
atgaaaggtgcaacatgcacaatcagtaatatcggttcagctggtggacaatggttcact
ccagttatcaatcacccagaagtagcaatcttaggaattggccgtattgctcaaaaacct
atcgttaaagatggagaaattgttgcagcaccagtattagcattatcattaagctttgac
cacagacaaattgatggtgcaactggccaaaatgcaatgaatcacattaaacgtttatta
aataatccagaattattattaatggaggggtaa

DBGET integrated database retrieval system