KEGG   Staphylococcus aureus subsp. aureus HO 5096 0412: SAEMRSA15_12210Help
Entry
SAEMRSA15_12210   CDS       T02059                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sux  Staphylococcus aureus subsp. aureus HO 5096 0412
Pathway
sux00260  Glycine, serine and threonine metabolism
sux00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sux01100  Metabolic pathways
sux01110  Biosynthesis of secondary metabolites
sux01130  Biosynthesis of antibiotics
sux01230  Biosynthesis of amino acids
Module
sux_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sux00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAEMRSA15_12210 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAEMRSA15_12210 (trpA)
Enzymes [BR:sux01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SAEMRSA15_12210 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth DUF561 IGPS
Motif
Other DBs
NCBI-ProteinID: CCG15934
Position
1356619..1357347
Genome map
AA seq 242 aa AA seqDB search
MTKLFIPYIMGNKDLIENATLLSENGTDIIEIGVPFSDPVADGPVIMEAGQQAIKQGITI
DYIFNQLEKHGDQIKCNYVLMTYYNIICHYGEQAFFEKCRDTGVYGLIIPDLPYELSQRL
KEQFSHYGVKIISLVAMTTDDKRMKDIVSHAEGFIYTVTMNATTGQNGAFHPELKRKIES
IKAIANVPVVAGFGIRTPQHVADIKEVADGIVIGSEIVKRFKSNTREEIIKYLQSIQQTL
NN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgactaaattatttataccttatattatgggcaataaagatttgattgaaaatgcaaca
ttgttgagtgaaaatggtacagatataattgaaattggtgtacctttctctgatccggtt
gctgatggtccagttatcatggaagcaggtcaacaggcgattaaacaaggcatcacgata
gattatattttcaatcaattagaaaaacatggtgatcaaattaagtgtaactatgtatta
atgacgtattataatattatttgtcattatggagaacaagcgttttttgaaaaatgtcga
gatactggtgtctacggcttaattattcctgatttaccatatgaattatcgcagcgttta
aaagaacaatttagtcactatggcgtcaaaatcatatcgttagttgcgatgactactgat
gacaaacgtatgaaagatatcgtatcccatgcggaaggctttatttatactgtgacgatg
aatgcgacaacagggcaaaacggtgcgtttcatccagaattaaaacgaaaaattgagtca
attaaagcgatagccaatgtgccagttgtcgcaggatttggtataagaacacctcaacat
gttgcagatataaaagaggttgcagatggcatcgtcattggtagcgaaatcgttaagcga
tttaaatctaacacgcgtgaagaaatcattaaatatttacaatctatccaacaaacattg
aataattaa

DBGET integrated database retrieval system