KEGG   Staphylococcus aureus subsp. aureus HO 5096 0412 (MRSA): SAEMRSA15_14570Help
Entry
SAEMRSA15_14570   CDS       T02059                                 

Gene name
gcvT
Definition
(GenBank) putative aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
sux  Staphylococcus aureus subsp. aureus HO 5096 0412 (MRSA)
Pathway
sux00260  Glycine, serine and threonine metabolism
sux00630  Glyoxylate and dicarboxylate metabolism
sux00670  One carbon pool by folate
sux01100  Metabolic pathways
sux01110  Biosynthesis of secondary metabolites
sux01130  Biosynthesis of antibiotics
sux01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sux00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAEMRSA15_14570 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAEMRSA15_14570 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAEMRSA15_14570 (gcvT)
Enzymes [BR:sux01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     SAEMRSA15_14570 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: CCG16168
Position
complement(1614763..1615854)
Genome map
AA seq 363 aa AA seqDB search
MSSDLKQTPLYQNYVDRGAKIVEFGGWAMPVQFSSIKEEHNAVRYEIGLFDVSHMGEIEV
TGKDASQFVQYLLSNDTDNLTTSKALYTALCNEEGGIIDDLVIYQLADDNYLLVVNAANT
EKDFNWILKHKEKFDVEVQNVSNQYGQLAIQGPKARDLINQLVDEDVTEMKMFEFKQGVK
LFGANVILSQSGYTGEDGFEIYCNIDDTEKIWDGLLEYNVMPCGLGARDTLRLEAGLPLH
GQDLTESITPYEGGIAFASKPLIDADFIGKSVLKDQKENGAPRRTVGLELLEKGIARTGY
EVMDLDGNIIGEVTSGTQSPSSGKSIALAMIKRDEFEMGKELLVQVRKRQLKAKIVKKNQ
IDK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagtgatttaaaacaaacacctttatatcaaaattatgttgatagaggtgcaaaa
attgtggaattcggaggatgggcgatgcctgttcaattttctagtattaaagaggaacat
aatgctgttcgatacgaaataggcctgtttgatgttagtcatatgggtgaaattgaagta
acaggtaaagatgctagtcagtttgtgcaatatttattatcaaatgatactgataattta
actacttcaaaagcattatatactgctttatgtaatgaagaaggcggtattattgatgat
ttagtaatatatcaattagctgacgacaattatttattagttgttaatgctgctaatact
gaaaaagattttaattggattttaaaacacaaagagaaatttgatgttgaagtacaaaat
gtatcaaaccaatatggtcaattagcaatacaaggaccaaaagctagagatttaattaat
caattagttgatgaagatgtaactgaaatgaaaatgtttgaatttaaacagggtgtcaaa
ttatttggagcaaacgtcattttatctcagtcaggttacacaggtgaagatgggtttgaa
atttattgtaatatcgatgatactgaaaaaatttgggatggtttattagagtataatgtt
atgccatgtggattaggcgctcgtgatacattaagattagaggctggattgccattacat
ggtcaagatttaactgaatcaattacaccatatgaaggtggtatcgcttttgcaagtaaa
ccattaattgatgctgattttattggtaaatctgtattaaaagatcaaaaagaaaatggt
gcaccaagaagaacagtgggattagaattacttgaaaaaggaattgcaagaactggttat
gaagttatggatttagatggaaatattattggagaagtaacttcaggaacacagtctcca
tcatcaggaaaatcaattgcacttgcaatgataaaaagagatgagtttgaaatgggtaaa
gagttgcttgttcaagttcgtaagcgtcaattaaaagcgaaaattgttaagaaaaatcaa
attgataaataa

DBGET integrated database retrieval system