KEGG   Staphylococcus aureus subsp. aureus HO 5096 0412: SAEMRSA15_19290Help
Entry
SAEMRSA15_19290   CDS       T02059                                 

Definition
(GenBank) putative peptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sux  Staphylococcus aureus subsp. aureus HO 5096 0412
Pathway
sux00300  Lysine biosynthesis
sux01100  Metabolic pathways
sux01120  Microbial metabolism in diverse environments
sux01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sux00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SAEMRSA15_19290
Enzymes [BR:sux01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SAEMRSA15_19290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: CCG16640
Position
2091552..2092775
Genome map
AA seq 407 aa AA seqDB search
MTTFSEKEKIQLLADIVELQTENNNEIDVCNYLTDLFDKYDIKSEILKVNEHRANIVAEI
GNGSPILALSGHMDVVDAGNQDNWTYPPFQLTEKAGKLYGRGTTDMKGGLMALVITLIEL
KEQNQLPQGTIRLLATAGEEKEQEGAKLLADKGYLDDVDGLIIAEPTGSGIYYAHKGSMS
CKVTATGKAVHSSVPFIGDNAIDTLLEFYNQFKEKYSELKKHDTKHELDVAPMFKSLIGK
EISEEDANYASGLTAVCSIINGGKQFNSVPDEASLEFNVRPVPEYDNDFIESFFQNIIND
VDSNKLSLDIPSNHRPVTSDKNSKLITTIKDVASSYVEQDDIFVSALVGATDASSFLGDN
KDNVDLAIFGPGNPLMAHQIDEYIEKDMYLKYIDIFKEASIQYLKEK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttttagtgaaaaagaaaaaattcaattactagcagatattgttgaactacaa
actgaaaataataatgaaatagacgtttgtaattatttaacagatttattcgacaagtat
gatattaaatctgaaattttgaaagttaatgaacaccgcgccaatatcgttgcagaaatc
ggtaacggctcacctatactcgcattgagtggtcatatggatgttgttgatgcaggaaat
caagataattggacttatcccccttttcaactcacagaaaaagctggcaaattatacggt
cgaggcacaacggatatgaaaggcggtctgatggctttggtcatcacactcattgaatta
aaagaacaaaatcaattgcctcaaggaacgataagattactagctactgctggcgaagag
aaagaacaagaaggtgccaaattattggctgataaaggctatttagacgatgtagatggc
ttaattattgctgaaccaactggatctggaatttattatgcacataaagggtctatgtca
tgtaaagtaactgcaactggcaaagctgtccatagctcagttccatttattggtgacaat
gcaattgatacactgcttgaattttataatcaatttaaagaaaaatattcagagcttaaa
aaacatgatactaaacatgaattagatgttgcacccatgttcaaatcattgataggaaaa
gaaatttctgaagaggatgcaaattatgcatctggtcttacagctgtatgttcgattata
aatggcggcaaacaatttaactctgtaccagatgaagcttcacttgaatttaacgtaaga
ccagttcctgagtatgataacgactttatagaatcgtttttccaaaatatcattaatgat
gtggatagcaataagctttcactcgatattccaagcaatcaccgacctgtaacaagcgat
aaaaatagcaaattaattactacgattaaagatgtagcttctagttatgtagaacaagac
gatatatttgtttcggcgcttgtaggtgcaacagatgcctctagtttcttaggtgataat
aaggacaatgttgatttagccatttttggaccaggtaatccattaatggcacatcaaatc
gatgaatatattgaaaaagatatgtatctgaaatatattgatatttttaaagaagcttcc
attcaatatttaaaagagaaataa

DBGET integrated database retrieval system