KEGG   Staphylococcus aureus 04-02981: SA2981_0553Help
Entry
SA2981_0553       CDS       T02070                                 

Gene name
vraB
Definition
(GenBank) 3-ketoacyl-CoA thiolase; Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
suy  Staphylococcus aureus 04-02981
Pathway
suy00071  Fatty acid degradation
suy00072  Synthesis and degradation of ketone bodies
suy00280  Valine, leucine and isoleucine degradation
suy00310  Lysine degradation
suy00362  Benzoate degradation
suy00380  Tryptophan metabolism
suy00620  Pyruvate metabolism
suy00630  Glyoxylate and dicarboxylate metabolism
suy00640  Propanoate metabolism
suy00650  Butanoate metabolism
suy00900  Terpenoid backbone biosynthesis
suy01100  Metabolic pathways
suy01110  Biosynthesis of secondary metabolites
suy01120  Microbial metabolism in diverse environments
suy01130  Biosynthesis of antibiotics
suy01200  Carbon metabolism
suy01212  Fatty acid metabolism
suy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:suy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SA2981_0553 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    SA2981_0553 (vraB)
   00640 Propanoate metabolism
    SA2981_0553 (vraB)
   00650 Butanoate metabolism
    SA2981_0553 (vraB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SA2981_0553 (vraB)
   00072 Synthesis and degradation of ketone bodies
    SA2981_0553 (vraB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SA2981_0553 (vraB)
   00310 Lysine degradation
    SA2981_0553 (vraB)
   00380 Tryptophan metabolism
    SA2981_0553 (vraB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SA2981_0553 (vraB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SA2981_0553 (vraB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SA2981_0553 (vraB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:suy04147]
    SA2981_0553 (vraB)
Enzymes [BR:suy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SA2981_0553 (vraB)
Exosome [BR:suy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SA2981_0553 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADC36764
Position
626359..627498
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
EVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaatatggtggcact
ttaaaacatttagagccagaacaattgcttaaacctttattccaacattttaaagagaag
tatccagaggtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatattgcaagaaaagcattgcttgaagcggggcttaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgcatgtcgcatgatc
caagccggagctggcaaggtatatattgcaggtggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaacagcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagcgacccatcaatgattcaaggtgctgaaaatgtggcc
aagatgtatgatgtttcaagagaattacaagatgaatttgcttatcgaagtcatcaactg
acagcggaaaatgtaaagaatggaaatatttctcaggaaatattacctataaccgttaaa
ggagaaatattcaatactgatgaaagtctaaaatcacatattccgaaagataactttggc
cgatttaagcccgtaatcaaaggtgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttttattgcttattatggaaaaagatatggcatacgaattaggtttcgag
catggtttattatttaaagatggtgttacggtaggtgttgattctaattttcctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcattgaaattaacgaagcgttcagtgcacaggtagttgcctgccaacaagcttta
aatatttcaaatacgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgactcgattattttatatgtttgacaaagagactatg
attgcatctatggggatagggggaggtctaggaaatgcagcattatttactcgattctaa

DBGET integrated database retrieval system