KEGG   Staphylococcus aureus 04-02981 (MRSA): SA2981_1669Help
Entry
SA2981_1669       CDS       T02070                                 

Gene name
ackA
Definition
(GenBank) Acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
suy  Staphylococcus aureus 04-02981 (MRSA)
Pathway
suy00430  Taurine and hypotaurine metabolism
suy00620  Pyruvate metabolism
suy00640  Propanoate metabolism
suy00680  Methane metabolism
suy01100  Metabolic pathways
suy01120  Microbial metabolism in diverse environments
suy01200  Carbon metabolism
Module
suy_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:suy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SA2981_1669 (ackA)
   00640 Propanoate metabolism
    SA2981_1669 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    SA2981_1669 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    SA2981_1669 (ackA)
Enzymes [BR:suy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     SA2981_1669 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ADC37880
Position
complement(1786431..1787633)
Genome map
AA seq 400 aa AA seqDB search
MSKLILAINAGSSSLKFQLIRMPEEELVTKGLIERIGLKDSIFTIEVNGEKVKTVQDIKD
HVEAVDIMLDAFKAHNIINDINDIDGTGHRVVHGGEKFPESVAITDEVEKEIEELSELAP
LHNPANLMGIRAFRKLLPNIPHVAIFDTAFHQTMPEKAYLYSLPYHYYKDYGIRKYGFHG
TSHKFVSQRAAEMLDKPIEDLRIISCHIGNGASIAAIDGGKSIDTSMGFTPLAGVTMGTR
SGNIDPALIPFIMEKTGKTAEQVLEILNKESGLLGLSGTSSDLRDLSEEAESGKARSQMA
LDVFASKIHKYIGSYAARMHGVDVIVFTAGIGENSVEIRAKVLEGLEFMGVYWDPKKNEN
LLRGKEGFINYPHSPVKVVVIPTDEESMIARDVMTFGGLK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaattaatcttggctatcaatgctggtagttcatcattaaaatttcaattaatt
agaatgcctgaagaggaattagtaacaaaaggtttaatagaaagaatcggattgaaggat
tcaatttttacaattgaagtcaacggggaaaaagttaaaacagtacaagatatcaaggat
cacgttgaggcagttgatatcatgttggatgcttttaaagcgcataatattattaatgat
attaacgatatcgatggaacaggtcaccgtgttgtacatggtggtgaaaaattccctgaa
tcagtagctattactgatgaggttgaaaaggaaattgaagaattaagcgaattagcaccg
cttcacaacccagctaacttgatgggtattcgtgctttccgtaagttattaccaaatatc
cctcatgtggcaatttttgatacagcattccatcaaacaatgcctgaaaaagcatatcta
tatagcttgccatatcattattataaagattatggcattcgtaagtatggtttccatggt
acaagccataaatttgtatcacaaagagcggcagaaatgttagataagccaattgaagat
ttacgtattatttcatgtcacattggtaatggagcatcaattgcagctatcgatggcggt
aaatctattgatacatcaatgggcttcacaccacttgctggtgtaacaatgggtactcgt
tctggtaatattgaccctgctttaattccatttattatggaaaaaacaggtaaaactgct
gaacaagtattggaaatcttaaacaaagaatcaggtttattaggattatcaggtacatct
agtgatttacgtgacttatcagaagaagctgaatcaggtaaagcacgttcacaaatggct
ttagatgtatttgcttctaaaattcacaaatatattggatcatatgctgcgagaatgcat
ggtgttgatgttatcgtatttacagcaggtatcggtgaaaactcagtagaaattcgtgcg
aaagttcttgaaggcttagaatttatgggtgtttactgggatcctaagaaaaatgaaaac
ttactacgtggtaaagaaggatttattaactatcctcattcaccagttaaagttgtcgtt
attccaacagatgaagaaagtatgattgcccgtgatgttatgacattcggtggtttaaaa
taa

DBGET integrated database retrieval system