KEGG   Staphylococcus aureus 04-02981: SA2981_2353Help
Entry
SA2981_2353       CDS       T02070                                 

Gene name
pgm
Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
suy  Staphylococcus aureus 04-02981
Pathway
suy00010  Glycolysis / Gluconeogenesis
suy00260  Glycine, serine and threonine metabolism
suy00680  Methane metabolism
suy01100  Metabolic pathways
suy01110  Biosynthesis of secondary metabolites
suy01120  Microbial metabolism in diverse environments
suy01130  Biosynthesis of antibiotics
suy01200  Carbon metabolism
suy01230  Biosynthesis of amino acids
Module
suy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
suy_M00002  Glycolysis, core module involving three-carbon compounds
suy_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:suy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SA2981_2353 (pgm)
  Energy metabolism
   00680 Methane metabolism
    SA2981_2353 (pgm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SA2981_2353 (pgm)
Enzymes [BR:suy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SA2981_2353 (pgm)
Membrane trafficking [BR:suy04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SA2981_2353 (pgm)
Exosome [BR:suy04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SA2981_2353 (pgm)
  Exosomal proteins of melanoma cells
   SA2981_2353 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADC38564
Position
complement(2486797..2487483)
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTR
ALDTTHYILTESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVK
PPAETEEQREAYLADRRYNHLDKRMMPYSESLKDTLVRVIPFWTDHISQYLLDGQTVLVS
AHGNSIRALIKYLEDVSDEDIINYEIKTGAPLVYELTDDLEVIDKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattaattttatgtcgtcatggacaaagcgagtggaatgctaaaaacttattt
actggatgggaagatgttaatttatctgaacaaggtattaatgaagcgactagagcaggt
gaaaaagtaagagaaaataacattgccatcgatgtagcttttacatcgttattaacacgt
gctttagatacaacgcattatattttaactgaatctaaacaacaatggattcctgtatat
aaaagctggcgtttaaatgaacgccactatggtggattgcaaggcttaaataaagatgat
gctagaaaagaatttggagaagaacaagtacatatttggcgtcgttcttatgatgtgaaa
ccacctgctgaaaccgaagaacaacgtgaagcttacttagctgatcgtcgatataatcat
ttagataaacgtatgatgccttattctgaaagtctgaaagatactttagttcgagtgata
ccattttggacagatcatatttcacaatatttgctagatggtcaaacggtattagtttct
gcacacggaaattcaattcgcgcattaattaaatatcttgaagatgtgtcagatgaagat
atcattaattatgaaattaaaacaggtgcaccgcttgtttatgaattaacggatgattta
gaagttatagataaatactacttataa

DBGET integrated database retrieval system