KEGG   Staphylococcus aureus 04-02981 (MRSA): SA2981_2498
Entry
SA2981_2498       CDS       T02070                                 

Gene name
crtN
Definition
(GenBank) Dehydrosqualene desaturase (Diapophytoene desaturase) (4,4-diapophytoene desaturase)
  KO
K10209  4,4'-diapophytoene desaturase [EC:1.3.8.2]
Organism
suy  Staphylococcus aureus 04-02981 (MRSA)
Pathway
suy00906  Carotenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:suy00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    SA2981_2498 (crtN)
Enzymes [BR:suy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.2  4,4'-diapophytoene desaturase (4,4'-diapolycopene-forming)
     SA2981_2498 (crtN)
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 FAD_binding_2 HI0933_like Pyr_redox FAD_oxidored AlaDh_PNT_C FMO-like UDPG_MGDP_dh_N NAD_Gly3P_dh_N Thi4 GIDA 3HCDH_N NAD_binding_9 MCRA ApbA NAD_binding_2 FAD_binding_3 F420_oxidored Pyr_redox_3 TrkA_N IlvN
Other DBs
NCBI-ProteinID: ADC38709
Position
complement(2651556..2653064)
AA seq 502 aa
MKIAVIGAGVTGLAAAARIASQGHEVTIFEKNNNVGGRMNQLKKDGFTFDMGPTIVMMPD
VYKDVFTACGKNYEDYIELRQLRYIYDVYFDHDDRITVPTDLAELQQMLESIEPGSTHGF
MSFLTDVYKKYEIARRYFLERTYRKPSDFYNMTSLVQGAKLKTLNHADQLIEHYIDNEKI
QKLLAFQTLYIGIDPKRGPSLYSIIPMIEMMFGVHFIKGGMYGMAQGLAQLNKDLGVNIE
LNAEIEQIIIDPKFKRADAIKVNGDIRKFDKILCTADFPSVAESLMPDFAPIKKYPPHKI
ADLDYSCSAFLMYIGIDIDVTDQVRLHNVIFSDDFRGNIEEIFEGRLSYDPSIYVYVPAV
ADKSLAPEGKTGIYVLMPTPELKTGSGIDWSDEALTQQIKEIIYRKLATIEVFEDIKSHI
VSETIFTPNDFEQTYHAKFGSAFGLMPTLAQSNYYRPQNVSRDYKDLYFAGASTHPGAGV
PIVLTSAKITVDEMIKDIERGV
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgaagattgcagtaattggtgcaggtgtcacaggattagcagcggcagcccgtattgct
tctcaaggtcatgaagtgacgatatttgaaaaaaataataatgtaggcgggcgtatgaat
caattaaagaaagacggctttacatttgatatgggtcccacaattgtcatgatgccagat
gtttataaagatgtttttacagcgtgtggtaaaaattatgaagattatattgaattgaga
caattacgttatatttacgatgtgtattttgaccacgatgatcgtataacggtgcctaca
gatttagctgaattacagcaaatgctagaaagtatagaacctggttcaacgcatggtttt
atgtcctttttaacggatgtttataaaaaatatgaaattgcacgtcgctatttcttagaa
agaacgtatcgcaaaccgagtgacttttataatatgacgtcacttgtgcaaggtgctaag
ttaaaaacgttaaatcatgcagatcagctaattgaacattatattgataacgaaaagata
caaaagcttttagcgtttcaaacgttatacataggaattgatccaaaacgaggcccgtca
ctatattcaattattcctatgattgaaatgatgtttggtgtgcattttattaaaggcggt
atgtatggtatggctcaagggctagcgcaattaaataaagacttaggcgttaatattgaa
ctaaatgctgaaattgagcaaattattattgatcctaaattcaaacgggccgatgcgata
aaagtgaatggtgacataagaaaatttgataaaattttatgtacggctgatttccctagt
gttgcggaatcattaatgccagattttgcacctattaaaaagtatccaccacataaaatt
gcagacttagattactcttgttcagcatttttaatgtatatcggtatagatattgatgtg
acagatcaagtgagacttcataatgttattttttcagatgactttagaggcaatattgaa
gaaatatttgagggacgtttatcatatgatccttctatttatgtgtatgtaccagcggtc
gctgataaatcacttgcgccagaaggcaaaactggtatttatgtgctaatgccgacgccg
gaacttaaaacaggtagcggaatcgattggtcagatgaagctttgacgcaacaaataaag
gaaattatttatcgtaaattagcaacaattgaagtatttgaagatataaaatcgcatatt
gtttcagaaacaatctttacgccaaatgattttgagcaaacgtatcatgcgaaatttggt
tcggcattcggtttaatgccaactttagcgcaaagtaattattatcgtccacaaaatgta
tcgcgagattataaagatttatattttgcaggtgcaagtacgcacccaggtgcaggcgtt
cctattgtcttaacaagtgcgaaaataactgtagacgaaatgattaaagatattgagcgg
ggcgtataa

DBGET integrated database retrieval system