KEGG   Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA): MS7_0344Help
Entry
MS7_0344          CDS       T01950                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
suz  Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA)
Pathway
suz00071  Fatty acid degradation
suz00072  Synthesis and degradation of ketone bodies
suz00280  Valine, leucine and isoleucine degradation
suz00310  Lysine degradation
suz00362  Benzoate degradation
suz00380  Tryptophan metabolism
suz00620  Pyruvate metabolism
suz00630  Glyoxylate and dicarboxylate metabolism
suz00640  Propanoate metabolism
suz00650  Butanoate metabolism
suz00900  Terpenoid backbone biosynthesis
suz01100  Metabolic pathways
suz01110  Biosynthesis of secondary metabolites
suz01120  Microbial metabolism in diverse environments
suz01130  Biosynthesis of antibiotics
suz01200  Carbon metabolism
suz01212  Fatty acid metabolism
suz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:suz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MS7_0344 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    MS7_0344 (thlA)
   00640 Propanoate metabolism
    MS7_0344 (thlA)
   00650 Butanoate metabolism
    MS7_0344 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MS7_0344 (thlA)
   00072 Synthesis and degradation of ketone bodies
    MS7_0344 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MS7_0344 (thlA)
   00310 Lysine degradation
    MS7_0344 (thlA)
   00380 Tryptophan metabolism
    MS7_0344 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MS7_0344 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MS7_0344 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MS7_0344 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:suz04147]
    MS7_0344 (thlA)
Enzymes [BR:suz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MS7_0344 (thlA)
Exosome [BR:suz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MS7_0344 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FAE1_CUT1_RppA ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AEW64377
Position
390403..391584
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEIDEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
NSQHKAVRAQQNGEFDSEIVPVSIPQRKGEPIVVTKDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGTHGVDPSIMGIAPVGAVEKA
LKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattgatgaagttatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaacagtacct
gcatttacagtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcag
tcaccaatgcttgtcaacaacagtcgcttcggttttaaaatgggacatcaatcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagtagagcaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacataaagcagtacgtgcacagcaaaatggtgaatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaaccaatagttgtcactaaggatgaaggtgta
cgtgaaaatgtatcagtcgaaaaactaagtcgcttaagaccagctttcaaaaaagacggt
acagttacagcaggtaatgcatcaggaattaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
actcatggtgtagatccttctattatgggtattgcaccagttggcgctgttgaaaaggct
ttgaaacgtagtaaaaaagaattaagcgatattgatgtatttgaattaaatgaagcattt
gcagcacaatcattagctgttgatcgtgaattaaaattacctcctgagaaggtgaatgtt
aaaggtggcgctattgcattaggacaccctattggtgcatctggtgctagagtattagtg
acattattgcatcaactgaatgatgaagttgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaaatataaataa

DBGET integrated database retrieval system