KEGG   Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA): MS7_0963Help
Entry
MS7_0963          CDS       T01950                                 

Definition
(GenBank) RNA pseudouridylate synthase family protein
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
suz  Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA)
Brite
KEGG Orthology (KO) [BR:suz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:suz03009]
    MS7_0963
Enzymes [BR:suz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     MS7_0963
Ribosome biogenesis [BR:suz03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    MS7_0963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 SAM_3
Motif
Other DBs
NCBI-ProteinID: AEW64975
Position
1011574..1012428
Genome map
AA seq 284 aa AA seqDB search
MKFKYHISQQETVKTFLARHDFSKKTVSAIKNNGALIVNDEPVTVRKQLMTNDILEIHLP
REIPSVNLIPYARKLEVLYEDAFIIIVTKPNNQNCTPSREHPHESLIEQVLYHCQEHGEN
INPHIVTRLDRNTTGIVIFAKYGHIHHLFSKVNLKKIYTCLVYGKTHTSGIIEANIRRSK
DSIITREVALDGKYAKTSYEVINQNDKYSLCKVHLHTGRTHQIRVHFQHIGHPIVGDSLY
DGFHDKIHGQVLQCTQIYFVHPINKNNIYITIDYKQLLKLFNQL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttaagtatcatatatcacaacaagaaactgttaaaacttttttagcacgacat
gatttttctaagaagacagtgagcgccattaaaaataatggcgctttaattgttaatgat
gaaccagtcacagtgcgtaagcaattaatgacaaatgatatattagaaattcatttaccg
cgagaaataccgagtgttaatttaataccttatgctcgtaagctagaagtattgtatgaa
gatgcttttatcatcatagttactaaaccaaacaatcaaaattgtacgccttcgagagaa
catcctcatgaaagtttaatcgaacaagtactatatcattgtcaggaacatggtgaaaat
attaacccacatattgttacgcgtctagatcgtaatacaactggtattgtgatattcgct
aaatatggacatatccatcatttattttctaaagtaaacttgaaaaaaatatatacttgc
cttgtatatggtaaaacccatacatctggtattattgaagctaatattagacggtcaaag
gatagtattataactagagaagttgccttggatggtaaatacgctaaaacatcttatgaa
gtaataaatcagaatgataaatacagtttatgcaaagttcatttgcatacgggacgtaca
catcaaattcgtgtacattttcaacatattgggcatccaattgtgggagattctttgtat
gatggttttcatgacaaaattcatggtcaagtactgcaatgtacgcaaatatattttgtt
catccaatcaataagaacaatatttatattacaattgattataagcaattacttaaatta
ttcaatcaactctaa

DBGET integrated database retrieval system