KEGG   Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA): MS7_1327Help
Entry
MS7_1327          CDS       T01950                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase family protein
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
suz  Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA)
Pathway
suz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
suz01100  Metabolic pathways
suz01110  Biosynthesis of secondary metabolites
suz01130  Biosynthesis of antibiotics
suz01230  Biosynthesis of amino acids
Module
suz_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:suz00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MS7_1327
Enzymes [BR:suz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MS7_1327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C FMN_dh BBE
Motif
Other DBs
NCBI-ProteinID: AEW65336
Position
1406499..1407281
Genome map
AA seq 260 aa AA seqDB search
MTILSEIVKYKQSLLQNGYYQDKLNTLKSVKIQNKKSFINAIEKEPKLAIIAEIKSKSPT
VNDLPERDLSQQISDYDQYGANAVSILTDEKYFGGSFERLQALTTKTTLPVLCKDFIIDP
LQIDVAKQAGASMILLIVNILSDKQLKDLYNYAISQNLEVLVEVHDRHELERAYKVNAKL
IGVNNRDLKRFVTNVEHTNTILENKKPNHYYISESGIHDASDVRKILHSGIDGLLIGEAL
MRCDNLSEFLPQLKMQKVKS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacgattttatcagaaattgttaaatataaacagtcacttttacaaaatggctattat
caagacaaacttaataccttgaaaagtgtgaagattcagaataaaaaatcttttataaac
gcaattgagaaagaaccaaagctagcaattattgcagaaattaaatcgaagagtcctaca
gttaatgacttacctgaacgagatttatcgcaacaaatctcagattatgaccaatatggt
gcaaatgccgtgtccattttaactgatgaaaagtactttggtggtagttttgaaagatta
caagcattgacgacaaaaacaacattacccgtattatgcaaagactttattatagacccg
cttcaaattgatgttgctaaacaagctggtgcatctatgattttattgatcgttaacatc
ttatctgataaacaattgaaagatttatataactacgctatatcgcaaaatctagaagtg
ttagttgaagtacatgatcgccatgaattagaacgtgcctataaggttaatgctaaattg
attggtgtaaataacagggacttaaaacgatttgttacaaatgtggaacatacaaatact
attttagaaaataaaaaaccaaatcattattatatttctgaaagtggtattcacgatgca
tctgatgtaagaaaaatcttgcatagtggtatcgatggcttactaataggtgaggcgctt
atgcgttgtgacaatctatctgaatttttaccacaactgaaaatgcaaaaggtgaagtca
tga

DBGET integrated database retrieval system