KEGG   Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA): MS7_1329Help
Entry
MS7_1329          CDS       T01950                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
suz  Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA)
Pathway
suz00260  Glycine, serine and threonine metabolism
suz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
suz01100  Metabolic pathways
suz01110  Biosynthesis of secondary metabolites
suz01130  Biosynthesis of antibiotics
suz01230  Biosynthesis of amino acids
Module
suz_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:suz00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MS7_1329 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MS7_1329 (trpB)
Enzymes [BR:suz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MS7_1329 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEW65338
Position
1407987..1409120
Genome map
AA seq 377 aa AA seqDB search
MPAIIELKKAYKEAKADPEFQRELEYYLSEYVGRATPLTYAASYTESLGGAKIYLKREDL
NHTGAHKINNALGQALLAKRMGKKKLVAETGAGQHGVASATVAALFDMELVVFMGSEDIK
RQQLNVFRMELLGAKVVAVEDGQGTLSDAVNKALQYWVSHVDDTHYLLGSALGPDPFPTI
VRDFQSVIGKEIKSQILKKEGRLPDAIVACIGGGSNAIGTFYPFIKDDVALYGVEAAGQG
EDTDKHALAIGKGSPGVLHGTKMYLIQDEDGQVQLAHSISAGLDYPGIGPEHSYYHDIGR
VTFENASDTQAMNALINFTKHEGIIPAIESAHALSYVERLAPTMSKEDIIVVTISGRGDK
DMETIRQYMAERGLAND
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaattattgagttgaaaaaagcttataaagaggcaaaagcagacccagagttt
caaagagaactggaatactatttatcagagtatgtaggacgcgcgacgccacttacatat
gctgcatcatatactgaaagcctaggtggcgctaaaatatatttgaaacgagaggatcta
aatcatacaggcgcccataaaattaataatgcgttaggtcaagcgttgcttgctaaaaga
atgggcaagaagaagcttgttgctgaaactggtgcgggccaacatggtgtagctagtgct
acggttgctgcattatttgatatggaacttgttgtctttatgggaagtgaagatattaaa
agacaacaacttaatgtatttagaatggaattacttggtgcaaaggttgtggcagttgaa
gatggtcaagggactttatcggatgcagttaataaagcattgcaatattgggtaagtcat
gtagatgatacacattatttattaggttctgcattaggtccagacccgttcccaacgatt
gttagagattttcagagtgtgattggtaaagaaataaaatcacagatattgaagaaagaa
ggtcgacttccggatgcaattgtagcatgtatcggtggtggctcaaatgcaatcggtaca
ttttatccatttattaaagatgatgttgcattatacggtgttgaagccgcaggtcaaggc
gaggatactgataaacatgcacttgcaattggcaaaggatcacctggcgtattacatggt
actaaaatgtatttaattcaagatgaagatgggcaagtgcaactagcacattctatttca
gcaggacttgattatcctggtattggaccagaacattcttattaccacgacattggtaga
gtaacttttgaaaatgcaagtgatacacaagcaatgaatgctttaatcaactttacaaaa
catgaaggtattatacctgcaattgaaagtgcacatgcactgagttatgttgaaagacta
gcgcctacgatgtcgaaagaagatattattgtagtaactatttctggacgtggcgataaa
gatatggaaacaattagacaatatatggcagagcgaggtcttgcaaatgactaa

DBGET integrated database retrieval system