KEGG   Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA): MS7_1701Help
Entry
MS7_1701          CDS       T01950                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
suz  Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA)
Pathway
suz00020  Citrate cycle (TCA cycle)
suz00480  Glutathione metabolism
suz01100  Metabolic pathways
suz01110  Biosynthesis of secondary metabolites
suz01120  Microbial metabolism in diverse environments
suz01200  Carbon metabolism
suz01210  2-Oxocarboxylic acid metabolism
suz01230  Biosynthesis of amino acids
Module
suz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
suz_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:suz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MS7_1701 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MS7_1701 (icd)
Enzymes [BR:suz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     MS7_1701 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AEW65708
Position
complement(1798190..1799458)
Genome map
AA seq 422 aa AA seqDB search
MTAEKITQGTEGLNVPNEPIIPFIIGDGIGPDIWKAASRVIDAAVEKAYNGEKRIEWKEV
LAGQKAFDTTGEWLPQETLDTIKEYLIAVKGPLTTPIGGGIRSLNVALRQELDLFTCLRP
VRWFKGVPSPVKRPQDVDMVIFRENTEDIYAGIEFKEGTTEVKKVIDFLQNEMGATNIRF
PETSGIGIKPVSKEGTERLVRAAIQYAIDNNRKSVTLVHKGNIMKFTEGSFKQWGYDLAL
SEFGDQVFTWQQYDEIVEKEGRDAANAAQEKAEKEGKIIIKDSIADIFLQQILTRPAEHD
VVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLNKVNPSS
VILSSVLMLEHLGWQEAADKITDSIEDTIASKVVTYDFARLMDGAEEVSTSAFADELIKN
LK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgactgcagaaaaaattactcaaggaactgaaggattaaacgtacctaatgaaccaatt
atcccatttattatcggtgatggaattggaccggatatttggaaggcagcaagccgagtt
atagatgctgctgttgagaaagcctataatggcgaaaaacgcattgaatggaaagaagtg
ctagctggccaaaaagcatttgatacaactggtgaatggttacctcaagaaacacttgat
acaattaaagaatatttaattgctgttaaaggacctttaacaacaccaattggtggtggt
attagatcattaaatgtggctttacgccaagaattagatttatttacttgtttaagaccg
gtacgttggtttaaaggagtaccatcacctgttaaacgtccacaagatgttgatatggtt
attttccgtgaaaatactgaagacatttatgctggtattgaatttaaagaaggtacaaca
gaagttaaaaaggtaattgacttcttacaaaacgaaatgggtgcgacaaacattcgattc
ccagaaacttcaggtattggtattaaaccagtttctaaagaaggaactgagcgattagtt
agagcagctatacaatatgctatcgataataaccgtaaatcagttactttagttcataaa
ggtaatattatgaaatttacagaaggctcatttaagcagtggggttacgatttagcatta
tctgaatttggtgatcaagtattcacttggcaacaatatgacgaaattgttgaaaaagaa
ggcagagatgctgctaatgctgctcaagaaaaagctgaaaaagaaggcaagattatcatt
aaagattctattgctgacattttcttacaacaaattttaactcgtccagctgagcatgat
gttgtagcaactatgaacttgaatggtgactatatttcagatgctttagctgcacaagtt
ggtggtattggtattgcgccaggtgcaaacattaattatgaaacaggtcatgctattttt
gaagcaacacatggtacagctccaaaatatgcaggtttaaataaagtgaatccatcttca
gtaattttaagttctgtattaatgttagaacatttaggatggcaagaagcggcagataag
attacagattcaattgaagatacaattgcttcaaaagttgttacttatgactttgcccgt
ttaatggatggtgctgaagaagtttctacatcagcatttgcagatgaattgattaaaaat
ttaaaataa

DBGET integrated database retrieval system