KEGG   Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA): MS7_1757Help
Entry
MS7_1757          CDS       T01950                                 

Definition
(GenBank) dipeptidase family protein
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
suz  Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA)
Pathway
suz00300  Lysine biosynthesis
suz01100  Metabolic pathways
suz01120  Microbial metabolism in diverse environments
suz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:suz00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    MS7_1757
Enzymes [BR:suz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     MS7_1757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AEW65764
Structure
PDB: 

Position
complement(1869287..1870696)
Genome map
AA seq 469 aa AA seqDB search
MWKEKVQQYEDQIINDLKGLLAIESVRDDAKASEDAPVGPGPRKALDYMYEIAHRDGFTT
HDVDHIAGRIEAGKGSDVLGILCHVDVVPAGDGWDSNPFEPVVTEDAIIARGTLDDKGPT
IAAYYAIKILEDMNVDWKKRIHMIIGTDEESDWKCTDRYFKTEEMPTLGFAPDAEFPCIH
GEKGITTFDLVQNKLAEDQDEPDYELITFKSGERYYMVPDHAEARVLVKENMTDVIQDFE
YFLEQNHLQGDSTVDSGILVLTVEGKAVHGMDPSIGVNAGLYLLKFLASLNLDNNAQAFV
AFSNRYLFNSDFGEKMGMKFHTDVMGDVTTNIGVITYDNENAGLFGINLRYPEGFEFEKA
MDRFANEIQQYGFEVKLGKVQPPHYVDKNDPFVQKLVTAYRNQTNDMTEPYTIGGGTYAR
NLDKGVAFGAMFSDSEDLMHQKNEYITKKQLFNATSIYLEAIYSLCVEE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaagaaaaagttcaacaatacgaagatcaaatcattaatgacttaaaaggatta
ttagcaattgaaagtgtgagagatgatgcaaaagcatcagaagacgcaccagttggtcca
ggtcctcgtaaggcattagactacatgtatgaaattgcacatagagatggatttacaaca
catgatgtggatcatattgcaggaagaattgaggcaggtaaaggaagtgacgtattaggt
atcttatgtcatgttgacgttgttcctgctggtgatggatgggatagtaatccgttcgag
ccggttgtaacagaagatgctatcatagctagaggtacacttgatgacaaaggtccaaca
attgctgcttattatgcaattaagatattagaagatatgaatgtggattggaagaaacgt
attcatatgattattggtacggatgaagaatctgattggaaatgtacggatcgctatttt
aaaacagaagaaatgccaacattaggttttgcaccagatgcagaatttccgtgtattcat
ggtgaaaaaggcattacaacatttgacttagttcaaaataagcttgctgaagatcaagat
gaacctgattatgaattaataacttttaaatctggtgaacgttactacatggtgcctgat
catgcagaagcaagagtgcttgttaaagaaaatatgacagatgttattcaagactttgag
tactttttagaacaaaatcatttacaaggtgatagtactgttgatagtggcattctagtt
ttaacagttgaaggtaaagcggttcatggtatggatccatctatcggtgtgaatgcgggt
ctttacttactaaaattcttagcatcattaaatcttgataataatgcacaagcgtttgta
gcatttagtaatcgctacttatttaattcagattttggtgaaaagatgggaatgaaattc
catacagatgtcatgggtgacgtgacaactaacattggtgttattacatatgataatgaa
aacgcaggtcttttcggtatcaacttacgctacccagaaggatttgaatttgaaaaagct
atggatcgttttgcaaatgagattcaacaatatggctttgaagtgaaattaggtaaagtc
caaccaccacattatgttgataaaaatgatccttttgtacaaaagttagttactgcatat
agaaatcaaacaaatgatatgactgaaccttatactataggtggcggtacttatgcgaga
aacttagacaagggtgtagcatttggcgcaatgtttagtgattctgaagatttaatgcat
cagaaaaatgaatatatcactaaaaaacagttatttaacgcaactagtatttacttagaa
gcaatttattcattatgcgtggaggaataa

DBGET integrated database retrieval system