KEGG   Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA): MS7_2141Help
Entry
MS7_2141          CDS       T01950                                 

Gene name
fba
Definition
(GenBank) fructose-1,6-bisphosphate aldolase, class II
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
suz  Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA)
Pathway
suz00010  Glycolysis / Gluconeogenesis
suz00030  Pentose phosphate pathway
suz00051  Fructose and mannose metabolism
suz00680  Methane metabolism
suz01100  Metabolic pathways
suz01110  Biosynthesis of secondary metabolites
suz01120  Microbial metabolism in diverse environments
suz01130  Biosynthesis of antibiotics
suz01200  Carbon metabolism
suz01230  Biosynthesis of amino acids
Module
suz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
suz_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
suz_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:suz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MS7_2141 (fba)
   00030 Pentose phosphate pathway
    MS7_2141 (fba)
   00051 Fructose and mannose metabolism
    MS7_2141 (fba)
  09102 Energy metabolism
   00680 Methane metabolism
    MS7_2141 (fba)
Enzymes [BR:suz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     MS7_2141 (fba)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: AEW66104
Structure
PDB: 

Position
complement(2224320..2225180)
Genome map
AA seq 286 aa AA seqDB search
MPLVSMKEMLIDAKENGYAVGQYNINNLEFTQAILEASQEENAPVILGVSEGAARYMSGF
YTIVKMVEGLMHDLNITIPVAIHLDHGSSFEKCKEAIDAGFTSVMIDASHSPFEENVATT
KKVVEYAHEKGVSVEAELGTVGGQEDDVVADGIIYADPKECQELVEKTGIDALAPALGSV
HGPYKGEPKLGFKEMEEIGLSTGLPLVLHGGTGIPTKDIQKAIPFGTAKINVNTENQIAS
AKAVRDVLNNDKEVYDPRKYLGPAREAIKETVKGKIKEFGTSNRAK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcctttagtttcaatgaaagaaatgttaattgatgcaaaagaaaatggttatgcggta
ggtcaatacaatattaataacctagaattcactcaagcaattttagaagcgtcacaagaa
gaaaatgcacctgtaattttaggtgtttctgaaggtgctgctcgttacatgagcggtttc
tacacaattgttaaaatggttgaagggttaatgcatgacttaaacatcactattcctgta
gcaatccatttagaccatggttcaagctttgaaaaatgtaaagaagctatcgatgctggt
ttcacatcagtaatgatcgatgcttcacacagcccattcgaagaaaacgtagcaacaact
aaaaaagttgttgaatacgctcatgaaaaaggtgtttctgtagaagctgaattaggtact
gttggtggacaagaagatgatgttgtagcagacggcatcatttatgctgatcctaaagaa
tgtcaagaactagttgaaaaaactggtattgatgcattagcgccagcattaggttcagtt
catggtccatacaaaggtgaaccaaaattaggatttaaagaaatggaagaaatcggttta
tctacaggtttaccattagtattacacggtggtactggtatcccgactaaagatatccaa
aaagcaattccatttggtacagctaaaattaacgtaaacactgaaaaccaaatcgcttca
gcaaaagcagttcgtgacgttttaaataacgacaaagaagtttacgatcctcgtaaatac
ttaggacctgcacgtgaagctatcaaagaaacagttaaaggtaaaattaaagagttcggt
acttcaaaccgcgctaaataa

DBGET integrated database retrieval system