KEGG   Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA): MS7_2551Help
Entry
MS7_2551          CDS       T01950                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
suz  Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA)
Pathway
suz00072  Synthesis and degradation of ketone bodies
suz00280  Valine, leucine and isoleucine degradation
suz00650  Butanoate metabolism
suz00900  Terpenoid backbone biosynthesis
suz01100  Metabolic pathways
suz01110  Biosynthesis of secondary metabolites
suz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:suz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MS7_2551
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    MS7_2551
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MS7_2551
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MS7_2551
Enzymes [BR:suz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     MS7_2551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N Chal_sti_synt_N ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AEW66503
Structure
PDB: 

Position
2657415..2658581
Genome map
AA seq 388 aa AA seqDB search
MTIGIDKINFYVPKYYVDMAKLAEARQVDPNKFLIGIGQTEMAVSPVNQDIVSMGANAAK
DIITDEDKKKIGMVIVATESAVDAAKAAAVQIHNLLGIQPFARCFEMKEACYAATPAIQL
AKDYLATRPNEKVLVIATDTARYGLNSGGEPTQGAGAVAMVIAHNPSILALNEDAVAYTE
DVYDFWRPTGHKYPLVDGALSKDAYIRSFQQSWNEYAKRQGKSLADFASLCFHVPFTKMG
KKALESIIDNADETTQERLRSGYEDAVDYNRYVGNIYTGSLYLSLISLLENRDLQAGETI
GLFSYGSGSVGEFYSATLVEGYKDHLDQAAHKALLNNRTEVSVDAYETFFKRFDDVEFDE
EQDAVHEDRHIFYLSNIENNVREYHRPE
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgacaataggtatcgataaaataaacttttacgttccaaagtactatgtagacatggct
aaattagcagaagcacgccaagtagatccaaacaaatttttaattggtattggtcaaact
gaaatggctgttagtcctgtaaaccaagacatcgtttcaatgggcgctaatgctgctaag
gacattataacagacgaagacaaaaagaaaattggtatggtaattgtggcaactgaatca
gcagttgatgctgctaaagcagccgctgttcaaattcacaacttattaggtattcaacct
tttgcacgttgctttgaaatgaaagaagcttgttatgctgcaacaccagcaattcaatta
gctaaagattatttagcaactagaccgaatgaaaaagtattagttattgctacagataca
gcacgttatggattgaattcaggcggcgagccaacacaaggtgctggcgcagttgcgatg
gttattgcacataatccaagcattttggcattaaatgaagatgctgttgcttacactgaa
gacgtttatgatttctggcgtccaactggacataaatatccattagttgatggtgcatta
tctaaagatgcttatatccgctcattccaacaaagctggaatgaatacgcaaaacgtcaa
ggtaagtcgctagctgacttcgcatctctatgcttccatgttccatttacaaaaatgggt
aaaaaggcattagagtcaatcattgataacgctgatgaaacaactcaagagcgtttacgt
tcaggatatgaagatgctgtagattataaccgttatgtcggtaatatttatactggatca
ttatatttaagcctaatatcattacttgaaaatcgtgatttacaagctggtgaaacaatc
ggtttattcagttatggctcaggttcagttggtgaattttatagtgcgacattagttgaa
ggctacaaagatcatttagatcaagctgcacataaagcattattaaataaccgtactgaa
gtatctgttgatgcatatgaaacattcttcaaacgttttgatgacgttgaatttgacgaa
gaacaagatgctgttcatgaagatcgtcatattttctacttatcaaatattgaaaataac
gttcgtgaatatcacagaccagagtag

DBGET integrated database retrieval system