KEGG   Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA): MS7_2613Help
Entry
MS7_2613          CDS       T01950                                 

Definition
(GenBank) AMP-binding enzyme family protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
suz  Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA)
Pathway
suz00010  Glycolysis / Gluconeogenesis
suz00620  Pyruvate metabolism
suz00640  Propanoate metabolism
suz00680  Methane metabolism
suz01100  Metabolic pathways
suz01110  Biosynthesis of secondary metabolites
suz01120  Microbial metabolism in diverse environments
suz01130  Biosynthesis of antibiotics
suz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:suz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MS7_2613
   00620 Pyruvate metabolism
    MS7_2613
   00640 Propanoate metabolism
    MS7_2613
  Energy metabolism
   00680 Methane metabolism
    MS7_2613
Enzymes [BR:suz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MS7_2613
Lipid biosynthesis proteins [BR:suz01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MS7_2613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Atu4866
Motif
Other DBs
NCBI-ProteinID: AEW66565
Position
complement(2722111..2723709)
Genome map
AA seq 532 aa AA seqDB search
MQKSALFAPEKYNIISEIEKYSHIPDKKAILYHNTEGEDISVTYQQLIEQSNKVGNVLAS
HGLSKGDKVLIMMPRSIATYELYIAALKLGVAIIPCSEMLRTKDLQYRITHGEINAVIAL
EPFTVEFEKIKEYDALTKFVIAGQKDGWISLEAEKENASNKLEMADTTRDDMAILSYTSG
TTGNPKAVTHCHGWGFAHLQMAPKHWLCINEDDLVWATAAPGWQKWVWSPFLSVLGSGAT
AFVFNGRFSPETYLELLQKYQINVLCCTPTEYRMMAKLQNLNDYDLTHLHSAVSAGEPLN
REVVEQFKKYFNLTVRDGYGQTESTLLIGFLKDTPQRIGSMGKGIPGSSVTVVDDEGNSV
PANTKGNIAVPLDLPALFKGYYKEPERTAKAQTGKYYITGDLAHVDDDGYFWFEGRRDDI
IISSGYTIGPFEVEDALTNHPAVKECAVVAKPHDIRGNIVKAFVILQDHTAGDDTLVKEL
QQFVKNEVAPYKYPREIEFVDDLPKTNSGKIRRVELRDSEIEKWQQQKDSNQ
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagtcagctctattcgcgcctgaaaaatataacattatttcggaaatcgaaaaa
tatagccacataccagataaaaaggcaattttatatcataatactgaaggcgaagatata
tcagtcacttaccaacagctcattgaacagtctaataaagtaggtaatgttttagcatcg
cacggtttatctaaaggcgataaagtactcattatgatgccacgatctattgcgacgtat
gaattatatattgctgctttaaaattaggtgttgcaatcattccatgttctgaaatgcta
agaactaaagatttacaataccgtatcacacatggtgaaattaatgcagttattgcacta
gagccattcacagttgaatttgaaaaaattaaagaatatgatgcgttaactaaatttgtt
attgccggtcaaaaagatggatggatttcacttgaagctgaaaaagaaaacgcaagtaac
aaactagaaatggcagatacgacgcgtgatgatatggcgattctgtcatatacatctggt
acaactggcaatcctaaagccgttacacattgtcatggatggggatttgcacatttacaa
atggcaccaaaacattggttatgtattaatgaagatgacttagtttgggcaacagcagca
ccaggttggcaaaaatgggtatggagtcctttcttatctgtattaggttcaggtgcaact
gcttttgtatttaatggaaggttcagtcctgaaacatacttagaattgcttcaaaaatat
caaattaatgttttatgttgtacaccgacagaatatcgtatgatggctaaattacagaac
ttaaatgattatgacttaacgcatttacatagtgccgtttctgcaggtgagccactaaat
cgagaagtagttgaacaattcaagaaatactttaatttaactgtaagagatggatatggc
cagactgaaagtaccttgcttataggctttttaaaagatacaccacagaggattggatca
atgggtaaaggcattccgggtagttcggtcactgtagtagatgatgaggggaatagcgta
cctgctaatacgaaagggaatattgcagtaccacttgatttgccagcacttttcaaaggg
tattataaagagccagaacgtacggcgaaagcgcaaacaggtaaatactacatcactggt
gacttagctcatgtagatgatgatggttatttctggtttgaaggacgtcgagatgacatt
attattagttcaggctatacgattgggccttttgaagttgaagatgcgttaacgaatcat
ccagccgttaaagaatgtgctgtagtagcaaaacctcatgatatacgaggaaatattgtt
aaagcattcgttattttacaggaccatactgcgggtgatgatacgttagttaaagaacta
caacaatttgttaaaaatgaagttgcaccatataaatatccgagagagattgaattcgtt
gacgacttaccaaaaacaaactcaggtaaaattcgtcgtgttgaactacgagattctgaa
atagaaaaatggcaacaacaaaaagatagcaatcaataa

DBGET integrated database retrieval system