KEGG   Sulfurifustis variabilis: SVA_0004Help
Entry
SVA_0004          CDS       T05321                                 

Definition
(GenBank) magnesium transporter ApaG
  KO
K06195  ApaG protein
Organism
sva  Sulfurifustis variabilis
Brite
KEGG Orthology (KO) [BR:sva00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    SVA_0004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 Chitin_bind_4
Motif
Other DBs
NCBI-ProteinID: BAU46587
UniProt: A0A1B4VCM6
Position
complement(5343..5723)
Genome map
AA seq 126 aa AA seqDB search
MQPDRHRIDITVRTTYVPGQSAPDRNRYVFAYTITITNAGSVPARLVTRHWVITDANEKT
QEVRGEGVVGEQPYLEPGMSFEYTSGTILETPVGVMRGSYQMVADDGTRFDADIPAFTLS
VPRTLH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccgatcgacaccgaatcgacatcaccgtcaggacgacctacgtcccgggacag
tccgctcccgaccgtaatcggtatgtcttcgcgtacacgatcaccattacaaatgcggga
tccgtgccggcgcgactcgttacccgtcactgggtgatcacggacgccaacgagaaaaca
caggaggtgcgcggcgagggtgtcgtcggggaacagccctatctcgagcccgggatgagc
ttcgagtacacgagcgggaccatcctggagacgcccgtgggtgtcatgcggggaagctac
caaatggtggccgacgacggcacgcggttcgacgcggacatccctgccttcacgctcagc
gtgccgcgcacgctgcactga

DBGET integrated database retrieval system