KEGG   Sulfurifustis variabilis: SVA_3459Help
Entry
SVA_3459          CDS       T05321                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
sva  Sulfurifustis variabilis
Pathway
sva00630  Glyoxylate and dicarboxylate metabolism
sva01100  Metabolic pathways
sva01110  Biosynthesis of secondary metabolites
sva01120  Microbial metabolism in diverse environments
sva01130  Biosynthesis of antibiotics
sva01200  Carbon metabolism
Module
sva_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:sva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SVA_3459
Enzymes [BR:sva01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     SVA_3459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: BAU49995
UniProt: A0A1C7AFC6
Position
complement(3492701..3493135)
Genome map
AA seq 144 aa AA seqDB search
MMSNHGNRITQGQFSFLPDLTDEQITAQIKYALENGWAVNVEYTDDPHPRNTYWEMFGMP
MFDLKDPAGILMEINNCRKTFPNHYVRVTAFDSTRGWETPRMSFIVNRPKKEPGYGLERQ
EVDGRQIRYTIRPYATEKPEGERY
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcaatcacggcaaccgcattacgcagggccagttctcgttcctgcccgatctg
acggacgagcagatcacggcgcagatcaagtacgccctcgagaacggctgggcggtcaac
gtcgaatacacggatgacccgcacccgcgcaacacctactgggagatgttcggcatgccc
atgttcgatctcaaggatccggccggcatcctcatggagatcaacaactgccgcaagacg
ttccccaatcactacgtccgcgtgacggcgttcgactcgacgcgtggctgggagactccg
cgcatgtcgttcatcgtcaaccggccgaagaaggagccgggctatgggctggagcgtcag
gaggtcgacggacggcagattcgctacacgatccgtccgtatgccaccgagaagccggag
ggcgagcgctattag

DBGET integrated database retrieval system