KEGG   Streptomyces venezuelae: SVEN_0728Help
Entry
SVEN_0728         CDS       T02274                                 

Definition
(GenBank) Low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sve  Streptomyces venezuelae
Pathway
sve00260  Glycine, serine and threonine metabolism
sve01100  Metabolic pathways
sve01110  Biosynthesis of secondary metabolites
sve01120  Microbial metabolism in diverse environments
sve01130  Biosynthesis of antibiotics
sve01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sve00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SVEN_0728
Enzymes [BR:sve01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SVEN_0728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2 Glyco_hydro_20
Motif
Other DBs
NCBI-ProteinID: CCA54015
UniProt: F2R9R5
Position
complement(839429..840511)
Genome map
AA seq 360 aa AA seqDB search
MTAALGPRTDARRHHDPSVRGFASDNYAGAHPEVLAALALANDGHQVAYGEDQYTEHLQR
IMHGHFGPTAEAFPVFNGTGANVTALQALTDRWGAVICAESAHINVDEGGAPERMGGLKL
LTVPTPDGKLTPELIDRQAWGWEDEHRAMPQVVSITQNTELGTVYTVDEIRAIVEHSHAK
GMKVHLDGARIANAAASLDVPMRAFTNAVGVDVISYGGTKNGMLFGEAVVVLNPDAVSHM
KHLRKLSMQLASKMRFVSVQLEALLAKDLWLRNARHSNAMAQRLAAGVRELDGVEILYPV
QANAVFARLPHDVTRRLQERFRFYFWDEKAGDVRWMCAFDTTEDDVDAFLQALKEELARQ
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcggcactcggccccaggaccgacgcacgtcggcaccacgacccgtcggtccgg
ggcttcgccagcgacaactacgccggcgcccaccccgaggtcctcgcggccctagccctc
gccaacgacggccaccaggtcgcctacggcgaggaccagtacaccgagcacctccagcgg
atcatgcacggccacttcggccccaccgccgaggccttcccggtcttcaacgggaccggc
gcgaacgtgaccgcgctccaggcgctcaccgaccgctggggcgccgtgatctgcgccgag
tccgcgcacatcaacgtggacgagggcggggcgccggagcggatgggcggcctcaagctg
ctcaccgtgcccaccccggacggcaagctcacccccgagctgatcgaccggcaggcctgg
ggctgggaggacgagcaccgggcgatgccgcaggtcgtctcgatcacccagaacaccgag
ctgggcaccgtctacacggtggacgagatccgtgcgatcgtcgagcactcccacgccaag
ggcatgaaggtgcacctcgacggcgcccggatagccaacgccgccgcctccctggacgtg
ccgatgcgcgcgttcaccaacgcggtgggcgtcgacgtcatctcgtacggcggcacgaag
aacggcatgctcttcggcgaggccgtcgtcgtcctcaacccggacgcggtcagccacatg
aagcacctgcgcaagctgtccatgcagctcgcgtcgaagatgcgcttcgtgtcggtgcag
ctggaggccctcctcgcgaaggacctctggctgcgcaacgcccgccactccaacgcgatg
gcccagcgcctcgcggccggggtgcgcgagctcgacggggtcgagatcctctacccggtg
caggccaacgccgtcttcgcccggctgccgcacgacgtgacccggcggctccaggagcgc
ttccgcttctacttctgggacgagaaggcgggcgacgtccgctggatgtgcgccttcgac
accacggaggacgacgtggacgccttccttcaggccctgaaggaagagctggcccgccag
tag

DBGET integrated database retrieval system