KEGG   Streptomyces venezuelae: SVEN_0797Help
Entry
SVEN_0797         CDS       T02274                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sve  Streptomyces venezuelae
Pathway
sve00480  Glutathione metabolism
sve00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SVEN_0797
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SVEN_0797
Enzymes [BR:sve01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SVEN_0797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: CCA54084
UniProt: F2R9Y4
Position
924328..924810
Genome map
AA seq 160 aa AA seqDB search
MSLYDIPLKTLTGEPTSLADYRDRAVLIVNVASKCGLTPQYAGLEKLQQEYGERGFTVLG
VPCNQFAGQEPGSADEIQTFCSTTYGVSFPLLEKTDVNGEARHPLYTELVQIADAEGEAG
DVQWNFEKFLIGRDGRVTRFRPRTEPDAPEIVSAIEAQLA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgtacgacattccgctgaagaccctcaccggcgagccgacctccctcgccgac
taccgggaccgcgcggtcctgatcgtgaacgtcgcgtccaagtgcggactcaccccgcag
tacgcgggcctggagaagctgcagcaggagtacggcgagcgcggcttcaccgtgctcggc
gtgccctgcaaccagttcgccggccaggagcccggcagcgccgacgagatccagaccttc
tgctcgacgacgtacggcgtctccttcccgctcctggagaagaccgacgtcaacggcgag
gcccgtcacccgctctacaccgagctggtccagatcgccgacgccgagggcgaggcgggt
gacgtgcagtggaacttcgagaagttcctgatcggccgcgacggccgggtcacccgcttc
cgtccccgcaccgagcccgacgcccctgagatcgtctccgcgatcgaggcccagcttgcc
tga

DBGET integrated database retrieval system