KEGG   Streptomyces venezuelae: SVEN_1079Help
Entry
SVEN_1079         CDS       T02274                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
sve  Streptomyces venezuelae
Pathway
sve00230  Purine metabolism
sve01100  Metabolic pathways
Module
sve_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SVEN_1079
Enzymes [BR:sve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SVEN_1079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 RsgA_GTPase AAA_18 AAA_29 AAA_33 AAA_22 AAA_30 Rad17 AAA_25 ABC_tran CbiA AAA_5 CPT RNA_helicase AAA_23 AAA_24
Motif
Other DBs
NCBI-ProteinID: CCA54366
UniProt: F2RCK8
Position
complement(1223156..1223728)
Genome map
AA seq 190 aa AA seqDB search
MAAEVRPRLTVLSGPSGVGKSTVVAHMRKVHPEVWLSVSATTRKPRPGEKHGVHYFFVTD
DEFDKLIANGELLEWAEFAGNRYGTPRGAVLDRLDSGEPVLLEIDLQGARQVKDSMPESQ
LVFLAPPSWEELVRRLTGRGTESPEVIERRLSAAKVELAAESEFDTTLVNTSVEDVAREL
LTLMLLTSGE
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagaggtacgtccgcggctgaccgtgctctccggcccctcaggggtcggcaag
agcacggtcgtcgcgcatatgcgcaaggtccaccccgaggtctggctctcggtgtccgcg
acgacacggaagccccgccccggcgagaagcacggcgtccactacttcttcgtgacggac
gacgagttcgacaagctgatcgccaacggtgagctcctcgaatgggccgagttcgcgggc
aaccgctacggcaccccgcgcggcgcggtcctcgaccgcctggactccggcgaacccgtc
ctcctggagatcgacctccagggcgcccgccaggtgaaggactcgatgcccgagtcccag
ctggtcttcctggccccgccgagctgggaggaactggtccgccgcctcaccggccgcggc
accgagtcgccggaggtcatcgagcgccgtctgtcggccgcgaaggtcgagctggcggcc
gagtcggagttcgacaccacccttgtcaacacctccgtcgaggacgtagcacgtgagctg
ctaacgttgatgctgttgacttctggggaatga

DBGET integrated database retrieval system