KEGG   Streptomyces venezuelae: SVEN_1574Help
Entry
SVEN_1574         CDS       T02274                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sve  Streptomyces venezuelae
Pathway
sve00010  Glycolysis / Gluconeogenesis
sve00051  Fructose and mannose metabolism
sve00562  Inositol phosphate metabolism
sve01100  Metabolic pathways
sve01110  Biosynthesis of secondary metabolites
sve01120  Microbial metabolism in diverse environments
sve01130  Biosynthesis of antibiotics
sve01200  Carbon metabolism
sve01230  Biosynthesis of amino acids
Module
sve_M00002  Glycolysis, core module involving three-carbon compounds
sve_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SVEN_1574
   00051 Fructose and mannose metabolism
    SVEN_1574
   00562 Inositol phosphate metabolism
    SVEN_1574
Enzymes [BR:sve01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SVEN_1574
Exosome [BR:sve04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SVEN_1574
  Exosomal proteins of bladder cancer cells
   SVEN_1574
  Exosomal proteins of melanoma cells
   SVEN_1574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CCA54861
UniProt: F2RGQ0
Position
complement(1754950..1755729)
Genome map
AA seq 259 aa AA seqDB search
MSSTRTPLMAGNWKMNLNHLEAIAHVQKLAFALTDKDYDACEVAVLVPFTDLRSVQTLVD
GDKLKIKYGAQDISAHDSGAYTGEISGLMLSKLKCSYVAVGHSERRQYHAEDDEVCNAKV
KAAFKHGVTPILCVGEGLDIRKAGQQVEYTLAQLDGGLKDVPAEQAESIVIAYEPVWAIG
TGEVATPEDAQEVCGAIRGRLAELYSQELADKVRIQYGGSVKSGNVAAIMAQPDVDGALV
GGAALDADEFVKIVRFRDQ
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagcacccgcaccccgctgatggcgggcaactggaagatgaacctcaaccacctc
gaggccatcgcccacgtccagaagctcgccttcgcgctgacggacaaggactacgacgcc
tgtgaggtcgcggtcctggttcccttcaccgacctgcggtccgtacagaccctggtcgac
ggcgacaagctcaagatcaagtacggcgcccaggacatctcggcgcacgactccggtgcc
tacaccggagagatctcgggcctgatgctgtccaagctgaagtgctcctacgtggccgtc
ggccactccgagcgccgccagtaccacgccgaggacgacgaggtctgcaacgccaaggtg
aaggccgccttcaagcacggcgtgaccccgatcctctgcgtcggcgagggcctcgacatc
cgcaaggccggccagcaggtcgagtacaccctcgcccagctcgacggcggcctgaaggac
gtcccggccgagcaggccgagtccatcgtgatcgcgtacgagccggtgtgggccatcggc
accggcgaggtcgcgacccccgaggacgcccaggaggtctgcggggcgatccgcggccgc
ctcgccgagctgtactcgcaggagctggccgacaaggtccgcatccagtacggcggctcc
gtcaagtccggcaacgtcgccgcgatcatggcgcagcccgacgtcgacggcgccctggtg
ggcggcgcggcactcgacgccgacgagttcgtcaagatcgtccgcttccgcgaccagtga

DBGET integrated database retrieval system