KEGG   Streptomyces venezuelae: SVEN_2243Help
Entry
SVEN_2243         CDS       T02274                                 

Definition
(GenBank) Phospholipase C
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
sve  Streptomyces venezuelae
Pathway
sve00562  Inositol phosphate metabolism
sve00564  Glycerophospholipid metabolism
sve00565  Ether lipid metabolism
sve01100  Metabolic pathways
sve01110  Biosynthesis of secondary metabolites
sve02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SVEN_2243
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SVEN_2243
   00565 Ether lipid metabolism
    SVEN_2243
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SVEN_2243
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:sve02042]
    SVEN_2243
Enzymes [BR:sve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     SVEN_2243
Bacterial toxins [BR:sve02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   SVEN_2243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756
Motif
Other DBs
NCBI-ProteinID: CCA55529
UniProt: F2R112
Position
2417713..2419767
Genome map
AA seq 684 aa AA seqDB search
MADLDRRRFLQLAGGAAAFTMLSESVARAAAIPAQGSTGTIQDIEHIVVLMQENRSFDHY
FGAMKGVRGFGDPRPVTLPSGKSVWNQSDGSKVTLPFRPTSDKLGMEYLQGLNHDWAGGQ
SAFNKGKYDNWVPAKTKATMAHLTREDIPFHYALADAFTICDAYHCSFIGATDPNRYYMW
TGYVGNDGKGGGPVLNNAEAGYGWTTYPERLEAAGVSWKIYQDIGDGLNAAGSWGWINDA
FRGNYGDNSLLYFNNYRNAQPGNPLYDKARTGTNAKAGEGFFDILRADVQGGRLPKVSWI
AAPEAFSEHANWPSNYGAWYIAQVLDALTSNPDVWARTALFITYDENDGFFDHVVPPYAP
GSAAQGLSTAPTALDYFGGKTGYVAGPYGLGPRVPMIVVSPWSTGGYTCSETFDHTSVIR
FMEQRFGVTEPQISPWRRAVCGDLTSAFDFSRTDTSAAPLPPVAGYYPPDKNRHPDFLAT
APASGTMPRQERGAKPTRPLKYAPYVDGAADIAAGKFRLTFSGGPAAGAQFYVTSANRTD
APWTYTAEAAKSISDTWNTTYSKGVTDLTVHGPNGFVRRFRSPGKTAVPEVTARHNATTG
QLDLTFTNAGTTATVTLTNAYGGTPATLTVAKGATVTRAVDVSAAHRWYDITVTSSASTD
YVRRLAGHVETGAPSQSDPAILTY
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atggccgacctcgaccgtcgccggttccttcaactcgccggcggcgccgccgcgttcacg
atgctctcggagagcgtcgcgcgggccgccgcgataccggcgcagggctccaccggcacg
atccaggacatcgagcacattgtcgtcctgatgcaggagaatcgttccttcgatcactat
ttcggagcgatgaagggcgtacggggcttcggcgacccgcgcccggtgaccctgcccagc
ggcaagtccgtctggaaccagtccgacggcagcaaggtcacgctcccgttccggccgacc
agcgacaagctcggcatggagtacctccagggcctcaaccacgactgggcgggcggccag
agcgccttcaacaagggcaagtacgacaactgggtgcccgccaagaccaaggccaccatg
gcccacctcacccgcgaggacatcccgttccactacgcgctcgccgacgccttcaccatc
tgcgacgcgtaccactgctcgttcatcggagcgaccgaccccaaccgctactacatgtgg
accggttacgtcggcaacgacggcaagggcggcggccccgtcctgaacaacgccgaggcg
ggctacggctggaccacctaccccgagcgcctggaggcggccggcgtctcctggaagatc
taccaggacatcggcgacggcctgaacgccgccggctcctggggctggatcaacgacgcc
ttccgcggcaactacggcgacaactcgctgctctacttcaacaactaccgcaacgcccag
cccggcaaccccctctacgacaaggcccgcacgggcacgaacgccaaggccggcgagggc
ttcttcgacatcctccgcgccgacgtgcagggcgggcggctgccgaaggtctcctggatc
gcggccccggaggccttctccgagcacgccaactggccctccaactacggcgcctggtac
atcgcccaggtcctggacgcgctgacctccaacccggacgtgtgggcccgtaccgccctg
ttcatcacgtacgacgagaacgacggcttcttcgaccacgtggtcccgccgtacgccccc
ggctccgcggcgcagggcctgtcgacggcccccaccgccctcgactacttcggcggcaag
accggctacgtcgccggcccctacggcctcggcccgcgcgtcccgatgatcgtcgtctcg
ccctggtccaccggcggctacacctgctccgagaccttcgaccacacctcggtcatccgc
ttcatggagcagcgcttcggcgtcaccgagccgcagatctcgccctggcggcgggccgtc
tgcggcgacctgacctcggccttcgacttctcgcgcacggacacctcggcggccccgctg
ccgccggtcgcgggctactacccgccggacaagaaccgtcacccggacttcctcgccacc
gccccggcgtccggcacgatgccccgccaggaacgcggcgccaagcccacccgcccgctg
aagtacgccccgtacgtcgacggcgccgccgacatcgcggcgggcaagttccgtctgacc
ttcagcggcggccccgcggccggcgcccagttctacgtgacctcggcgaaccgcacggac
gccccgtggacgtacaccgccgaggccgccaagtcgatctcggacacctggaacacgacg
tactcgaagggcgtcaccgacctcacggtgcacggccccaacggcttcgtccggcgcttc
cgctcccccggcaagacggccgtccccgaggtcacggcccgccacaacgccaccaccggc
cagctggacctcaccttcaccaacgcgggcacgaccgccacggtgaccctcaccaacgcc
tacggcggcaccccggccaccctcaccgtcgcgaagggcgccacggtcacccgcgccgtg
gacgtctccgccgcccaccgctggtacgacatcaccgtcacgtcctccgcgagcacggac
tacgtccgccgcctcgcgggccacgtcgagacaggcgcgccgagccagtccgacccggcg
atcctgacgtactga

DBGET integrated database retrieval system