KEGG   Streptomyces venezuelae: SVEN_2674Help
Entry
SVEN_2674         CDS       T02274                                 

Definition
(GenBank) Nicotinamidase
  KO
K08281  nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
sve  Streptomyces venezuelae
Pathway
sve00760  Nicotinate and nicotinamide metabolism
sve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SVEN_2674
Enzymes [BR:sve01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     SVEN_2674
    3.5.1.-  
     SVEN_2674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase
Motif
Other DBs
NCBI-ProteinID: CCA55960
UniProt: F2R4T9
Position
2908811..2909410
Genome map
AA seq 199 aa AA seqDB search
MHRALIVVDVQNDFCEGGSLAVTGGADVAAAITDLVGQTAGTSYRHVVATRDHHVDPGEH
FAPAGEQPDYVSSWPVHCVAGTEGVGFHPNFAPAVASGAIDAVFDKGAYSAAYSGFEGFD
ENGRTLADWLRARDVTEVDVVGIATDHCVRATALDAARAGFRTHVLLDLTAGVAKETTDR
ALEELRTAGVELTGKPVVA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcgcattgatcgttgtggacgtgcagaacgacttctgcgagggcggcagcctc
gcggtgaccgggggcgcggacgtcgccgccgccatcaccgacctggtcggccagacggcg
ggcacctcctaccggcacgtggtcgccacccgcgaccaccacgtcgacccgggcgagcac
ttcgccccggcgggcgagcagccggactacgtgtcctcctggccggtgcactgcgtggcc
ggcacggagggcgtcggcttccacccgaacttcgcgcccgccgtggcgagcggcgcgatc
gacgccgtgttcgacaagggcgcgtactccgcggcgtacagcggcttcgagggcttcgac
gagaacgggcggacgctcgcggactggctgcgcgcgcgggacgtgaccgaggtggacgtg
gtcggcatcgcgaccgaccactgcgtccgggccacggccctggacgcggcgcgggcgggc
ttccggacccacgtcctgctcgatctgacggccggcgtggccaaggagaccacggaccgg
gccctggaggagctccggacggcgggcgtggagctgacgggcaagccggtggtggcctga

DBGET integrated database retrieval system