KEGG   Streptomyces venezuelae: SVEN_3333Help
Entry
SVEN_3333         CDS       T02274                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sve  Streptomyces venezuelae
Pathway
sve00010  Glycolysis / Gluconeogenesis
sve00620  Pyruvate metabolism
sve00640  Propanoate metabolism
sve00680  Methane metabolism
sve01100  Metabolic pathways
sve01110  Biosynthesis of secondary metabolites
sve01120  Microbial metabolism in diverse environments
sve01130  Biosynthesis of antibiotics
sve01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SVEN_3333
   00620 Pyruvate metabolism
    SVEN_3333
   00640 Propanoate metabolism
    SVEN_3333
  Energy metabolism
   00680 Methane metabolism
    SVEN_3333
Enzymes [BR:sve01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SVEN_3333
Lipid biosynthesis proteins [BR:sve01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SVEN_3333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CCA56619
UniProt: F2RAD7
Position
3651544..3653664
Genome map
AA seq 706 aa AA seqDB search
MWPLLPPLGRKGPPHVRRLTGLNQLPGGSCHPGLRLMSYDAGHIRTEDALGKGDVVSNES
LANLLREERRFSPPAELAAHANVTAEAYEQAKADRLGFWAEQAKRLTWATEPTETLDWSN
PPFAKWFADGELNVAYNCVDRHVEAGHGDRVAIHFEGEPGDSRAITYAELKDEVSKAANA
LTELGVRKGDRVAVYLPMIPEAAITMLACARVGAAHSVVFGGFSADAVASRIQDADAKLV
VTADGGYRRGKPSALKPAIDEAVAKCPQVEHVLVVRRTGQETAFTEGRDVWWDDIVTRQS
AEHTPEAFEAEHPLFILYTSGTTGKPKGILHTSGGYLTQAAYTHHAVFDLKPETDVYWCT
ADIGWVTGHSYIVYGPLANGATQVMYEGTPDTPHQGRFWEIVQKYGVTILYTAPTAIRTF
MKWGDDIPAKFDLSSLRVLGSVGEPINPEAWVWYREHIGAGKTPIVDTWWQTETGAMMIS
PLPGVTETKPGSAQRPLPGIAATVVDDEANEVPNGGGGYLVLTEPWPSMLRTIWGDDQRY
IDTYWSRFEGKYFAGDGAKKDDDGDIWLLGRVDDVMLVSGHNISTTEVESALVSHPSVAE
AAVVGAADETTGQAIVAFVILRGSASQDESLVAELRNHVGATLGPIAKPKRILPVAELPK
TRSGKIMRRLLRDVAENRELGDVTTLTDSSVMSLIQTQLPAASSED
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
gtgtggccccttctccccccgctcgggaggaaggggccaccccacgtcagacgactcaca
ggtctaaaccagttgcctggaggctcttgtcacccgggcctccgactgatgagctatgac
gcgggacacatacgcacagaggacgccctgggaaagggagatgtcgtgagcaacgaaagc
ctggccaatctgcttcgggaagagcgtcgattttcgccgcccgccgagctggccgcgcac
gccaacgtgacggcggaggcgtacgagcaggccaaggcggacaggctgggcttctgggcc
gagcaggccaagcgcctgacctgggccaccgagccgaccgagaccctcgactggtcgaac
ccgccgttcgccaagtggttcgcggacggcgagctgaacgtggcgtacaactgcgtcgac
cggcacgtcgaggccggccacggcgaccgggtcgccatccacttcgagggcgagccgggc
gacagccgggcgatcacctacgccgagctcaaggacgaggtctccaaggcggccaacgcc
ctgaccgagctgggcgtccgcaagggcgaccgcgtcgccgtctacctgccgatgatcccc
gaggcggccatcacgatgctggcctgcgcccgcgtcggcgccgcccactcggtggtcttc
ggcggcttctcggcggacgccgtggcctcccgcatccaggacgccgacgccaagctggtc
gtcaccgccgacggcggctaccgccggggcaagccgagcgcgctgaagccggccatcgac
gaggccgtcgccaagtgcccgcaggtcgagcacgtgctggtggtccgccgtacgggccag
gagaccgcgttcaccgagggccgtgacgtgtggtgggacgacatcgtcacccgccagtcg
gcggagcacaccccggaggccttcgaggcggagcacccgctcttcatcctctacacctcc
ggcaccacgggtaagccgaagggcatcctgcacacctccggcggctacctcacccaggcc
gcgtacacccaccacgccgtcttcgacctcaagccggagaccgacgtctactggtgcacc
gccgacatcggctgggtcaccgggcactcgtacatcgtctacggcccgctggccaacggc
gcgacgcaggtcatgtacgagggcacgccggacaccccgcaccaggggcggttctgggag
atcgtgcagaagtacggcgtcacgatcctctacacggcgcccaccgcgatccggacgttc
atgaagtggggcgacgacatccccgccaagttcgacctgtcgagcctccgggtgctcggt
tcggtcggcgagccgatcaaccccgaggcatgggtctggtaccgcgagcacatcggcgcg
ggcaagacgccgatcgtggacacctggtggcagaccgagaccggcgcgatgatgatctcg
ccgctgccgggcgtcaccgagaccaagccgggctccgcgcagcgtccgctgcccggcatc
gcggcgaccgtcgtcgacgacgaggccaacgaggtgccgaacggcggcggtggctacctg
gtcctcaccgagccgtggccgtcgatgctccgcaccatctggggcgacgaccagcgctac
atcgacacctactggtcccgcttcgagggcaagtacttcgccggtgacggcgcgaagaag
gacgacgacggcgacatctggctgctcggccgggtcgacgacgtcatgctcgtctcgggt
cacaacatctcgaccaccgaggtcgagtcggccctcgtctcgcacccgtccgtcgccgag
gcggccgtcgtcggcgccgccgacgagacgaccggtcaggccatcgtcgccttcgtgatc
ctgcggggttcggcgagccaggacgagagcctggtcgccgagctgcgcaaccacgtcggc
gcgaccctcggtccgatcgccaagccgaagcggatcctgccggtggcggagctgccgaag
acccgctcgggcaagatcatgcgccgtctgctgcgggacgtggcggagaaccgtgagctg
ggtgacgtcaccaccctgaccgactcctcggtcatgtcgctcatccagacccagctgccg
gccgcctccagcgaggactga

DBGET integrated database retrieval system