KEGG   Streptomyces venezuelae: SVEN_4109Help
Entry
SVEN_4109         CDS       T02274                                 

Definition
(GenBank) Methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sve  Streptomyces venezuelae
Pathway
sve00450  Selenocompound metabolism
sve00970  Aminoacyl-tRNA biosynthesis
sve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sve00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SVEN_4109
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SVEN_4109
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sve01007]
    SVEN_4109
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sve03016]
    SVEN_4109
Enzymes [BR:sve01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SVEN_4109
Amino acid related enzymes [BR:sve01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SVEN_4109
Transfer RNA biogenesis [BR:sve03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SVEN_4109
 Prokaryotic type
   Other AARSs
    SVEN_4109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e APC1_C TetR_C_6
Motif
Other DBs
NCBI-ProteinID: CCA57395
UniProt: F2RH67
Position
4448697..4450262
Genome map
AA seq 521 aa AA seqDB search
MSTPVWITATPPATHGELHIGHLAGPYVAADVLTRYLRAEGEAVRFTTGTADHASSVEVR
ALRHHRKPEEVAEGYRAAITADWLRSGVEFDHIVRPRRDKGYARWVQDLFGRLFAQGVIA
PRTRLLPYCEPCDRWLYGAHATGTCPHCGAVSDGGMCHECARPNDGGDLIAARCALCDTP
AVARRCRRLYVPLEPFRETLADYWATAGLPPRLAALCESLVEDGLPDIAVGHPAEWGLPV
PVEGFPDHRIDGCFEAAAMHLFGYDVTGPLPRRAIHFCGFGHAFCHAVLLPVLLLAQDIK
LPQDFNVNESYVIEEGVQEGNVWALDLLTEYGSDTLRRHVLQARPLGRRTVFHRERLAAA
RRELDENWNSWLSRLFAAVREECDGLAPQALPGGTGWEVLERRLHRGVDDLREAYGPDAF
DPRRAVAVLDEMVRSVADFGHVNAHERCRPSTSCRHLPALAGQLAVASALSAWSRPVMPE
GADRLASALQVSPGRPVDWQALTAPLPGTRLAPPSGPIFGF
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgagcacccctgtctggatcaccgcgaccccgccggccacccacggcgaactccacatc
ggccatctcgccgggccgtacgtcgccgccgacgtcctcacccgctatctgcgcgcggag
ggcgaggccgtccggttcaccaccggcaccgccgaccacgccagctccgtggaggtacgg
gcgctgcgccaccaccgcaagcccgaggaggtcgcggagggctaccgggcggcgatcacg
gcggactggctccggtcgggcgtggagttcgaccacatcgtgcgtccccgccgcgacaag
ggctacgcgcgctgggtgcaggacctgttcggccggctcttcgcgcagggcgtcatcgcc
ccgcgcacccgtctcctcccgtactgcgagccctgcgaccgctggctgtacggggcgcac
gccaccggcacctgcccgcactgcggtgcggtgagcgacggcggcatgtgccacgagtgc
gcccgcccgaacgacggcggcgacctgatcgcggcccgctgcgcgctctgcgacaccccg
gcggtggcccgccgctgccgccggctctacgtccccctggagccgttccgggagacgctc
gccgactactgggcgacggcggggctgccgcctcggctggccgcgctgtgcgagtcgctc
gtcgaggacggcctgcccgacatcgcggtcggccacccggccgagtgggggctgccggtg
cccgtcgagggcttccccgaccatcggatcgacggctgcttcgaggcggccgcgatgcac
ctcttcggctacgacgtgacgggcccgctgccccgccgcgccatccacttctgcggcttc
ggacacgccttctgccacgccgtgctgctgccggtgctgctgctcgcgcaggacatcaag
ctgccgcaggacttcaacgtcaacgagtcgtacgtgatcgaggagggcgtccaggagggc
aacgtgtgggcgctcgacctgctcaccgagtacggctccgacaccctgcgccgccatgtc
ctgcaggcccgtccgctgggccgccgcacggtcttccaccgggagcggctcgccgcggcc
cggcgcgagctggacgagaactggaacagctggctgtcccggctcttcgccgccgtacgg
gaggagtgcgacggcctcgccccgcaggcgctgcccggcggcaccggctgggaggtcctg
gagcggcggctgcaccggggcgtggacgacctccgagaggcgtacggccccgacgccttc
gacccgcggcgggcggtggccgtgcttgacgagatggtccgctcggtggcggacttcggt
cacgtcaacgcccacgagaggtgccgccccagcacctcgtgccgtcaccttccggcgctg
gccgggcagttggcggtggcctcggcactgtcggcgtggtcgcggccggtgatgccggag
ggtgccgaccggctcgcgtcggcgctccaggtgtccccggggcgcccggtcgactggcag
gccctgaccgccccgcttccggggacccgcctggcaccgccgtcgggcccgatcttcgga
ttctga

DBGET integrated database retrieval system