KEGG   Streptomyces venezuelae: SVEN_5455Help
Entry
SVEN_5455         CDS       T02274                                 

Definition
(GenBank) Glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
sve  Streptomyces venezuelae
Pathway
sve00860  Porphyrin and chlorophyll metabolism
sve01100  Metabolic pathways
sve01110  Biosynthesis of secondary metabolites
sve01120  Microbial metabolism in diverse environments
Module
sve_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
sve_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sve00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SVEN_5455
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sve01007]
    SVEN_5455
Enzymes [BR:sve01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     SVEN_5455
Amino acid related enzymes [BR:sve01007]
 Aminotransferase (transaminase)
  Class III
   SVEN_5455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: CCA58741
UniProt: F2R6W2
Position
5916095..5917411
Genome map
AA seq 438 aa AA seqDB search
MSGVGTGGGGTASKALFERAREVTPGGVNSPVRAFGAVGGTPPFMASAQGPYLTDADGNE
YVDLICSWGPMILGHRHPAVVEAVTGALALGTSFGAPSTGEVELAEEIVDRVDPVEQVRL
VSSGTEATMSAIRLARGFTGRGKIVKFAGCYHGHVDALLASAGSGLATFALPDTPGVTGA
QASDTIVLPYNDLAAVEKVFAEIGDEIAAVITEAAPGNMGAVPPLPGFNAGLKDVTSRHG
ALFISDEVMTGFRASRSGWYGRDGVAPDLLTFGKVMGGGFPAAAFGGRADVMAHLAPAGP
VYQAGTLSGNPVATAAGLATLRHSTPEVYERLDEVSATLGREVSAALTKEGVAHRVQYSG
TMFSVFFTEDEVTDFDGVRATESYRYSPFFHELLRRGVYLPPSPFEAWFVSAAHDDRAVG
RVVEALPAAAAAAASVKP
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgtgggaaccggcggcggaggaaccgcaagcaaggcgctcttcgagcgggcc
cgcgaggtcacccccggcggcgtcaactccccggtgcgcgccttcggggccgtcggcggc
accccgcccttcatggcctcggcccagggcccgtacctcaccgacgccgacggcaacgag
tacgtcgacctgatctgctcctggggcccgatgatcctcggccaccggcacccggccgtc
gtcgaggcggtcaccggggccctggcgctcggcacctccttcggcgcgccgtccaccggg
gaggtcgagctcgcggaggagatcgtcgaccgggtcgacccggtcgagcaggtccgcctc
gtcagctccggcaccgaggcgacgatgtcggcgatccgcctcgcccgcggcttcaccggg
cgcggcaagatcgtgaagttcgccggctgctaccacggccacgtggacgccctgctcgcc
tcggccggctccggcctcgccaccttcgccctccccgacaccccgggcgtcaccggcgcg
caggcgagcgacacgatcgtcctgccgtacaacgacctcgccgcggtcgagaaggtcttc
gcggagatcggcgacgagatcgccgccgtgatcacggaggccgcgcccgggaacatgggc
gccgtcccgccgctgcccggcttcaacgcgggcctgaaggacgtcacctcccgccacggg
gcgctcttcatctccgacgaggtgatgaccggcttccgggccagccgctccggctggtac
ggccgggacggcgtcgcgcccgacctgctgaccttcggcaaggtcatgggcggcggcttc
cccgcggcggccttcggcggccgcgcggacgtcatggcccacctggccccggccgggccc
gtgtaccaggcgggcaccctctcggggaacccggtcgccaccgccgccggcctcgcgacc
ctccggcacagcacccccgaggtgtacgagcggctcgacgaggtctcggccaccctcggc
cgtgaggtctcggccgccctgaccaaggagggcgtggcgcaccgggtccagtactccggc
accatgttctcggtcttcttcaccgaggacgaggtgaccgacttcgacggggtgcgcgcc
accgagtcgtaccgctattcgccgttcttccacgagctcctgcgccggggcgtctatctg
ccgccctcgcccttcgaggcctggttcgtctcggccgcgcacgacgaccgggcggtcggc
cgggtggtcgaggcgctcccggcggcggcagcggcagcggcgtccgtgaagccctga

DBGET integrated database retrieval system