KEGG   Streptomyces venezuelae: SVEN_5568Help
Entry
SVEN_5568         CDS       T02274                                 

Definition
(GenBank) Malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sve  Streptomyces venezuelae
Pathway
sve00620  Pyruvate metabolism
sve00630  Glyoxylate and dicarboxylate metabolism
sve01100  Metabolic pathways
sve01110  Biosynthesis of secondary metabolites
sve01120  Microbial metabolism in diverse environments
sve01200  Carbon metabolism
Module
sve_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SVEN_5568
   00630 Glyoxylate and dicarboxylate metabolism
    SVEN_5568
Enzymes [BR:sve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SVEN_5568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: CCA58854
UniProt: F2R845
Position
complement(6052905..6054503)
Genome map
AA seq 532 aa AA seqDB search
MTTSAPTRQVRVLAAPGDRHDEILTPDALDFVGRLAAAFGERRRWVLKERRRQAIRLATG
SPLDFPVATSGVRADRAWRVAPPAPGLTDRRVEITGPPERRMAVNALNSGARVWMADFED
ATAPTWDNVIGGQLVLLDAIERRIDFTTPEGKEYRLGEHLATIMVRPRGWHLDEEHLEFD
GRPVPASLVDFGLYFFHCAQRQIDAGHGPYFYLPKLENHYEARLWNDVFLLAQELLGIPR
GTVRATVLIETITAAFQMEEILHELREHSAGLNAGRWDYLFSLIKTFGHRTDFLLPDRAK
VTMTAPFMRAYTELLVRTCHRRGAHAIGGMAAQVPSKDPAAHEAALAKVRLDKEREAEDG
FDGSWVAHPGLVPVCREVFDGVLGDLPEQIHRTRDDVETTAADLLSVRRISGPPTAEGVR
TNIAVSLRYFDAWLRGQGAVAIDGLMEDAATAEIARVQIWQWLRHRVIDRESVLLVLDEE
LARLGAEYPWAALDEIRELFERTALAAELPLFFTPEAYTRHLVRTSTKEVTA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccagcgccccgacccgtcaggtccgtgtcctggccgcccccggcgaccgccac
gacgagatcctcacccccgacgccctcgacttcgtcggcaggctggccgccgccttcggc
gagcgccgccggtgggtcctgaaggagcgccgccgccaggccatccggctcgccaccggc
tccccgctcgacttccccgtcgccacctcgggcgtccgcgcggaccgcgcctggcgggtg
gccccgcccgcgccgggcctgaccgaccgcagggtcgagatcaccggcccgcccgagcgc
cggatggcggtgaacgcgctcaactccggagcgcgcgtgtggatggcggacttcgaggac
gccaccgcgcccacctgggacaacgtcatcggcgggcagctggtcctgctcgacgcgatc
gaacggcgcatcgacttcaccacgcccgagggcaaggagtaccgcctcggggagcacctc
gccacgatcatggtccggccgcgcggctggcacctcgacgaggaacacctggagttcgac
ggccgcccggtcccggcctcgctggtggacttcggcctgtacttcttccactgcgcgcag
cggcagatcgacgccggacacggcccgtacttctacctccccaagctggagaaccactac
gaggcccgactgtggaacgacgtgttcctcctcgcccaggagctcctgggcatcccccgg
ggcaccgtccgcgccaccgtcctgatcgagacgatcaccgcggccttccagatggaggag
attctccacgagttgcgcgagcacagcgcgggtctcaacgccggccgctgggactacctc
ttcagcttgatcaagaccttcggccaccgcaccgacttcctcctgcccgaccgggcgaag
gtcaccatgaccgcgcccttcatgcgggcgtacaccgaactcctggtccgcacctgccac
cggcggggagcgcacgccatcggcggcatggccgcccaggtccccagcaaggacccggcc
gcgcacgaggcggctctggccaaggtgcggctcgacaaggagcgggaggccgaggacggc
ttcgacggctcctgggtcgcccacccgggcctcgtccccgtgtgtcgggaggtcttcgac
ggtgtcctgggcgaccttccggagcagatccaccggacgcgtgacgacgtggagaccacg
gcggcggacctgctctccgtccgccggatcagcggcccgcccacggccgagggggtgcgc
accaacatcgccgtgtccctgcgctacttcgacgcctggctgcgcggtcagggggccgtg
gccatcgacggtctgatggaggacgccgctaccgccgagatcgcccgcgtccagatctgg
cagtggctgcgccaccgggtgatcgaccgggaatccgtgctcctggtcctcgacgaggag
ctggcacgactcggagcggagtacccgtgggccgcgctcgacgagatccgcgaactcttc
gagcggacggcgctcgccgccgaactgccccttttcttcacccccgaggcctacacacgc
catctcgtccggacctccaccaaggaagtgacggcatga

DBGET integrated database retrieval system