KEGG   Streptomyces venezuelae: SVEN_5569Help
Entry
SVEN_5569         CDS       T02274                                 

Definition
(GenBank) Isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
sve  Streptomyces venezuelae
Pathway
sve00630  Glyoxylate and dicarboxylate metabolism
sve01100  Metabolic pathways
sve01110  Biosynthesis of secondary metabolites
sve01120  Microbial metabolism in diverse environments
sve01200  Carbon metabolism
Module
sve_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SVEN_5569
Enzymes [BR:sve01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     SVEN_5569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: CCA58855
UniProt: F2R846
Position
complement(6054599..6055897)
Genome map
AA seq 432 aa AA seqDB search
MTVMAGTNTTTAAAADLAARWATDPRWDGIERTYTAEDVVRLSGNVREEHTLARRGAERL
WRQLHDLDYVHALGALTGGQAVQQVRAGLQAIYLSGWQVAADANQAGHTYPDQSLYPVNS
VPQVVRRINNALLRADQIATAEGGTDTTDWLAPIVADAEAGFGGPLNAFELTKAMIAAGA
AGIHYEDQLASEKKCGHLGGKVLVPTAQHIRTLNAARLAADIADTPTLIIARTDALAATL
LTSDIDERDAPFVTGERTAEGFYHVQNGMGPVIARGLAYAPYADLIWVETGTPDLAQARE
FAEAIHAQYPDQMLAYNCSPSFNWKAALDDDQIAKFQRELGAMGYKFQFITLAGFHSLNH
GMFDLARGYAEHGMTAYVDLQEREFAAQAQGFTAVKHQREVGTGYFDLVSTAVNPASSTT
ALAGSTEEEQFH
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtcatggcaggcacgaacacgacgacggcggccgcggcggacctggccgcgcgc
tgggcgacggacccccgctgggacgggattgagcgcacgtacaccgcggaggacgtcgta
cgcctctcgggcaacgtccgcgaggagcacaccctggcccggcgcggcgccgagcggctg
tggcgtcagctgcacgacctggactacgtccacgcgctcggcgcgctgaccggcgggcag
gccgtgcagcaggtcagggccggcctccaggcgatctacctgtcgggctggcaggtcgcc
gccgacgccaaccaggccgggcacacgtaccccgaccagagcctctacccggtcaactcc
gtcccgcaggtggtccgccggatcaataacgcgctgctgcgcgccgaccagatcgccacc
gccgagggcggcaccgacaccacggactggctcgcgccgatcgtcgccgacgccgaggcc
ggattcggcggcccgctcaacgccttcgagctcaccaaggccatgatcgcggccggcgcc
gccggcatccactacgaggaccagctcgcctccgagaagaagtgcggccacctcggcggc
aaggtcctcgtccccaccgcccagcacatccgcaccctcaacgcggcccgcctcgccgcc
gacatcgccgacaccccgaccctgatcatcgcccgcaccgacgcgctggccgccaccctg
ctcaccagtgacatcgacgagcgcgacgcacccttcgtcaccggcgagcgcaccgccgag
ggcttctaccacgtccagaacggcatgggccccgtcatcgcccgcggcctcgcctacgcc
ccgtacgccgacctcatctgggtcgagacaggcacccccgacctggcgcaggcccgggag
ttcgccgaggcgatccacgcccagtacccggaccagatgctcgcgtacaactgctcgccg
tccttcaactggaaggccgccctcgacgacgaccagatcgccaagttccagcgcgaactc
ggcgccatgggctacaagttccagttcatcaccctggccggcttccactccctcaaccac
ggcatgttcgacctcgcccgcggctacgccgagcacggcatgacggcctacgtcgacctc
caggagcgggagttcgccgcgcaggcacagggcttcaccgccgtcaagcaccagcgcgag
gtcggcaccggctacttcgacctggtgtccaccgcggtcaacccggcctcctcgacgacc
gcgctcgccggctccaccgaggaagagcagttccactaa

DBGET integrated database retrieval system