KEGG   Streptomyces venezuelae: SVEN_5576Help
Entry
SVEN_5576         CDS       T02274                                 

Definition
(GenBank) Enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sve  Streptomyces venezuelae
Pathway
sve00071  Fatty acid degradation
sve00280  Valine, leucine and isoleucine degradation
sve00281  Geraniol degradation
sve00310  Lysine degradation
sve00360  Phenylalanine metabolism
sve00362  Benzoate degradation
sve00380  Tryptophan metabolism
sve00410  beta-Alanine metabolism
sve00627  Aminobenzoate degradation
sve00640  Propanoate metabolism
sve00650  Butanoate metabolism
sve00903  Limonene and pinene degradation
sve00930  Caprolactam degradation
sve01100  Metabolic pathways
sve01110  Biosynthesis of secondary metabolites
sve01120  Microbial metabolism in diverse environments
sve01130  Biosynthesis of antibiotics
sve01212  Fatty acid metabolism
Module
sve_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SVEN_5576
   00650 Butanoate metabolism
    SVEN_5576
  Lipid metabolism
   00071 Fatty acid degradation
    SVEN_5576
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SVEN_5576
   00310 Lysine degradation
    SVEN_5576
   00360 Phenylalanine metabolism
    SVEN_5576
   00380 Tryptophan metabolism
    SVEN_5576
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SVEN_5576
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SVEN_5576
   00281 Geraniol degradation
    SVEN_5576
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SVEN_5576
   00627 Aminobenzoate degradation
    SVEN_5576
   00930 Caprolactam degradation
    SVEN_5576
Enzymes [BR:sve01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SVEN_5576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CCA58862
UniProt: F2R853
Position
6063740..6064525
Genome map
AA seq 261 aa AA seqDB search
MTTTDYETITVERTGDRTALLTLNRPKALNALNLQVMEEVVAATEALDRDPDIGCVVLTG
SAKAFAAGADIKEMQPQGYMDMYLTDWFTAWDRLGNLRTPTVAAVSGYALGGGCELAMLC
DILLASDTAVFGQPEIKLGVIPGIGGSQRLTRAVGKAKAMELCLTGRTMDAAEAERAGLV
SRIVPADDLLPEALAVAATVAGMSKPVAMMAKEAVNRAFETTLAEGVRFERRLFHAVFAT
ADQKEGMSAFVDKRAPDFTHR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgaccgactacgagacgatcaccgtcgagcgtacgggcgaccgcaccgcactg
ctcaccctcaaccggcccaaggcgctcaacgccctgaacctccaggtcatggaagaggtc
gtggccgccaccgaggccctcgaccgggacccggacatcggctgcgtcgtcctcaccggc
tccgcgaaggctttcgcggccggcgcggacatcaaggagatgcagccgcaggggtacatg
gacatgtacctcaccgactggttcaccgcctgggaccggcttgggaacctccgcaccccc
accgtcgccgccgtctccggctacgccctaggcggcggctgcgaactcgccatgctctgc
gacatcctgctggcctccgacacggcggtcttcgggcaaccggagatcaagctgggcgtc
atccctggcatcggcggctcccagcgcctcacccgcgccgtcggcaaggccaaggccatg
gagctgtgcctgacgggccggacgatggacgccgcagaagcggaacgtgcgggcctcgtc
tctcgtatcgtcccggccgacgacctccttcccgaggccctcgcggtcgcggcgaccgtg
gcagggatgtcgaagccagtcgcgatgatggccaaggaggccgtgaaccgcgccttcgag
accaccctcgcggaaggagtccgcttcgaacgccgcctgttccacgcggtgttcgccacc
gccgatcagaaggagggcatgtcggccttcgtcgacaagagggccccggacttcacccac
cgctga

DBGET integrated database retrieval system