KEGG   Streptomyces venezuelae: SVEN_6375Help
Entry
SVEN_6375         CDS       T02274                                 

Definition
(GenBank) hypothetical protein
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CCA59661
UniProt: F2REX6
Position
6962118..6962687
Genome map
AA seq 189 aa AA seqDB search
MLTPTPTATARAWLDSALTEAGARAPGWEERFVTAGRHCGREHADEARTLLLRAAAAGPD
TLTRLYHHGTAAERRAVLLALPSLVTGPEAVPLVEDALRTHDTTLLAAALGPYAATHLTP
HAWRHAVLKCLFTGVPVTTVAGLAERAAGDTELARMLTDHAAERTAAGRDLPAGLSLVLA
LTAPAEEPS
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgctgacccccacgcccaccgccaccgcccgcgcctggctggactccgccctcacggaa
gccggcgcccgcgcccccggctgggaggagcgcttcgtcaccgccggacggcactgcggg
cgcgagcacgcggacgaggcccgcacccttctcctccgggcggccgccgccggacccgac
accctcacccggctctaccaccacggcaccgccgccgagcgccgcgccgtcctcctggcc
ctcccctccctcgtcaccggccccgaggccgtgcccctcgtcgaagacgccctccgcacc
cacgacaccacgctgctcgccgccgccctcggcccctacgccgccacccacctcaccccg
cacgcctggcggcacgccgtcctcaaatgcctcttcaccggcgtccccgtcacgaccgtc
gccggactcgccgagcgagccgccggggacaccgaactcgcccggatgctcaccgaccac
gccgccgaacgcaccgccgccgggcgcgacctgcccgccggtctctccctcgtcctcgcc
ctcaccgcccccgccgaggagccctcctga

DBGET integrated database retrieval system