KEGG   Streptomyces venezuelae: SVEN_6376Help
Entry
SVEN_6376         CDS       T02274                                 

Definition
(GenBank) hypothetical protein
  KO
K07051  uncharacterized protein
Organism
sve  Streptomyces venezuelae
Brite
KEGG Orthology (KO) [BR:sve00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SVEN_6376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TatD_DNase PTE
Motif
Other DBs
NCBI-ProteinID: CCA59662
UniProt: F2REX7
Position
6962687..6963535
Genome map
AA seq 282 aa AA seqDB search
MRIFDPHIHMTSRTTDDYRAMYDAGVRALVEPSFWLGQPRTSPASFLDYFDSLLGWEPFR
AAQHGIAHHCALALNPKEANDPRCTPVLDVLPRHLAKDGVVAVGEIGYDSMTPAEDTALA
AQLQLAADHGLPALVHTPHRDKLTGLRRTIDVVRESALAPDRVLLDHLNETTVKEAADSG
AWLGFSVYPDTKMDEARTVTILKEYGTGRVLVNSAADWGRSDPLKTRAVADAMLAAGFTD
DDVDQVLWRNPVAFYGLSGRLHLDVPTPPDLHEGNSVRRGGE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcttcgacccccacatccacatgacctcgcgcaccacggacgactaccgcgcc
atgtacgacgccggtgtccgggccctcgtcgaaccctccttctggctcggccagccgcgc
acctccccggcctccttcctcgactacttcgactccctcctcggctgggagccgttccgc
gcggcccagcacggcatcgcccaccactgcgccctcgccctcaacccgaaggaggccaac
gacccccgctgcacccccgtcctcgacgtcctgccccgccatctcgccaaggacggcgtc
gtcgccgtcggcgagatcggctacgactccatgacacccgccgaggacaccgccctcgcc
gcccagctccagctcgccgccgaccacggtctgccggccctcgtccacaccccgcaccgc
gacaagctcaccggactgcgccgcacgatcgacgtcgtccgcgagtccgcgctcgccccc
gaccgcgtccttctcgaccacctcaacgagacgaccgtcaaggaggccgccgacagcggc
gcctggctcggcttctccgtctatcccgacaccaagatggacgaggcgaggacggtcacg
atcctcaaggagtacggaacgggccgcgtcctggtgaactcggccgccgactggggccgc
agcgacccgctcaagacccgcgcggtcgccgacgccatgctcgccgccggattcacggac
gacgacgtcgaccaggtcctctggcgcaaccccgtcgccttctacggcctcagcggccgt
ctccacctcgacgtacccaccccgcccgacctgcacgagggcaactccgtccgccgtggc
ggggaatga

DBGET integrated database retrieval system